Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13870XFF4834R_chr14720552_1587886_f2_XFF4834R-XFF4834R_chr13870XFF4834R_chr13870putative sensor protein of a two component system

XFF4834R_chr14720552_1587886_f2_XFF4834R-XFF4834R_chr13870 XFF4834R_chr13870
XFF4834R_chr13860
XFF4834R_chr13860
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13880
XFF4834R_chr13880
ID XFF4834R_chr14720552_1587886_f2_XFF4834R-XFF4834R_chr13870
AC XFF4834R_chr13870
LT XFF4834R_chr13870
OR XFF4834R_chr from 1586552 to 1587886 on strand +
DE putative sensor protein of a two component system
IP ATP-binding region, ATPase-like; Signal transduction histidine kinase/phosphatase, lantibiotic regulatory protein MprB
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component sensor activity (GO:0000155)

Curated
PM
AN
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20101008)
MW 49766.3 Da
SQ 444 aa
 
........10........20........30........40........50
| | | | |
MPESTSETRPARRRGRYRRRLRSRIILSFVLLGFCLTTLFAFATNWARSR
VENQLVEDVMNRNIDAFAQRFYSDPMRNPDLPLQQMRGRVVKSDKFEALR
REQPEWYQLPDGIHTITGVDESGNTYSYKLAVRKTPSEWFFLAYDMTQAL
KGEIQLKRTLILSVLVFSGFSLLIGWWSASKVMRPVSDLAARLRAYRGGN
SQPKPLAAHFPDDEVGQLAEALDDYSARLTEVVQRDREFNADVSHELRTP
LAVIRGATELLLTKPNLDEKVLQRLQRIQRAEQQCSDLIGSLLLLSRNER
GQGSSNVAKVAEQLIDSHRAQLGGKPLELLLEGVRDLVIDAPESALSVAL
GNLIGNAVKYTQDGQVRVRVLSDAVEVIDSGPGLSEEDAAKLFQRGYRGT
HAGHSQGGGIGLSIVSRLCDLYGWRVSVRPGQQRGVIATLAFHR
XFF4834R

XFF4834R_chr08410 lcl|XFF4834R_chr09020264_0980535_f1_XFF4834R-XFF4834R_chr08410

179

429

S=331 I=37 E=2.00594e-33

XFF4834R

XFF4834R_chr33180 lcl|XFF4834R_chr35850933_3814249_r3_XFF4834R-XFF4834R_chr33180

31

440

S=314 I=28 E=2.36339e-31

XFF4834R

XFF4834R_chr38410 lcl|XFF4834R_chr41490895_4436079_f1_XFF4834R-XFF4834R_chr38410

176

442

S=239 I=29 E=2.36624e-22

XFF4834R

XFF4834R_chr11650 lcl|XFF4834R_chr12140989_1302374_f3_XFF4834R-XFF4834R_chr11650

176

442

S=186 I=29 E=7.84187e-16

XFF4834R

XFF4834R_chr03000 lcl|baeS-XFF4834R_chr03000

213

423

S=178 I=31 E=5.87628e-15

sensory histidine kinase in two-component regulatory system with BaeR

XFF4834R

XFF4834R_chr16110 lcl|XFF4834R_chr17340755_1864378_f2_XFF4834R-XFF4834R_chr16110

239

428

S=161 I=31 E=7.0452e-13

XFF4834R

XFF4834R_chr18250 lcl|XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250

213

440

S=160 I=28 E=1.01608e-12

XFF4834R

XFF4834R_chr10450 lcl|phoR-XFF4834R_chr10450

227

435

S=160 I=30 E=1.02498e-12

sensory histidine kinase in two-component regulatory system with PhoB

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

238

440

S=159 I=31 E=1.18873e-12

XFF4834R

XFF4834R_chr14030 lcl|XFF4834R_chr14890928_1605685_r3_XFF4834R-XFF4834R_chr14030

239

419

S=158 I=30 E=1.57127e-12

X.species

YP_365095.1 lcl|colS-XCV3364

1

444

S=2071 I=90 E=0

two-component system sensor protein

X.species

NP_643557.1 lcl|colS-XAC3249

60

444

S=1841 I=92 E=0

two-component system sensor protein

X.species

NP_638453.1 lcl|colS-XCC3106

60

444

S=1818 I=90 E=0

two-component system sensor protein

X.species

lcl|XALc_0662

28

442

S=1492 I=70 E=1.69157e-173

putative two-component system sensor protein

X.species

lcl|XALc_2772

228

442

S=349 I=37 E=5.10917e-35

putative two-component system sensor protein

X.species

NP_636171.1 lcl|colS-XCC0780

214

428

S=336 I=38 E=1.95483e-33

two-component system sensor protein

X.species

YP_362619.1 lcl|XCV0888

179

441

S=333 I=37 E=4.21039e-33

two-component system sensor protein

X.species

NP_641187.1 lcl|colS-XAC0835

179

428

S=329 I=37 E=1.12771e-32

two-component system sensor protein

X.species

YP_362985.1 lcl|XCV1254

31

440

S=321 I=28 E=1.09768e-31

two-component system sensor protein

X.species

lcl|XALc_0891

177

440

S=319 I=32 E=2.18579e-31

putative two-component system sensor transmembrane protein

pubmed

25

428

S=345 I=30 E=5.71947e-33

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17166231

 

prodomImg

pubmed

175

428

S=342 I=36 E=1.34411e-32

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15491368

 

prodomImg

pubmed

175

435

S=335 I=36 E=8.38686e-32

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 9425686

 

prodomImg

pubmed

31

440

S=317 I=27 E=1.37627e-29

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 15195943

 

prodomImg

pubmed

175

442

S=274 I=32 E=2.13798e-24

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory s

Pubmed 7644502,8635730

 

prodomImg

pubmed

177

442

S=221 I=30 E=6.32616e-18

Sensor protein qseC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

Pubmed 10675023

 

prodomImg

pubmed

213

428

S=211 I=28 E=9.35773e-17

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 18957593

 

prodomImg

pubmed

176

422

S=208 I=29 E=2.14234e-16

Sensor protein basS/pmrB EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-c

Pubmed 8391535

 

prodomImg

pubmed

191

444

S=206 I=28 E=4.22898e-16

Sensor protein creC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compone

Pubmed 3531171

 

prodomImg

pubmed

175

442

S=205 I=28 E=5.30499e-16

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory

Pubmed 9172368,10784052

 

prodomImg

Iprscan [G3DSA:1.10.287.240]

225

297

-

Iprscan IPR003594 [G3DSA:3.30.565.10]

299

442

ATP-binding region, ATPase-like

Iprscan IPR003660 [PF00672]

160

231

HAMP linker domain

Iprscan IPR003661 [PF00512]

235

301

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [PF02518]

341

440

ATP-binding region, ATPase-like

Iprscan IPR003661 [SM00388]

235

301

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor region

Iprscan IPR003594 [SM00387]

341

444

ATP-binding region, ATPase-like

Iprscan IPR005467 [PS50109]

242

444

Signal transduction histidine kinase, core

Iprscan IPR003660 [PS50885]

180

234

HAMP linker domain

Iprscan [seg]

9

24

-

Iprscan [seg]

160

174

-

Iprscan [seg]

322

333

-

Iprscan [tmhmm]

21

43

-

PDA1L027

395

444

S=250 I=88 E=8.66964e-23

PD800393

25

72

S=218 I=81 E=7.19505e-19

PD259080

74

153

S=216 I=49 E=1.17241e-18

PD860237

294

349

S=185 I=73 E=7.68909e-15

PD822731

177

294

S=147 I=32 E=2.85882e-10

PDA907X8

129

238

S=115 I=29 E=1.79495e-06

PD884537

374

442

S=106 I=37 E=2.5641e-05

PD752323

337

393

S=105 I=37 E=3.10626e-05

PDA065Q2

182

315

S=105 I=28 E=3.30175e-05

PD297499

339

442

S=104 I=31 E=4.07024e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4Ft2ElzU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

234 hits
swiss-prot

Swiss-Prot ncbi-blastp

154 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

23 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF4Onno/XFF4834R_chr13870.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF4Onno/XFF4834R_chr13870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF4Onno/XFF4834R_chr13870.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF4Onno/XFF4834R_chr13870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.