Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13840rimKXFF4834R_chr13840probable ribosomal protein S6 modification protein

rimK XFF4834R_chr13840
XFF4834R_chr13830
XFF4834R_chr13830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13850
XFF4834R_chr13850
ID rimK
AC XFF4834R_chr13840
LT XFF4834R_chr13840
OR XFF4834R_chr from 1584306 to 1585193 on strand +
DE probable ribosomal protein S6 modification protein
IP S6 modification enzyme RimK; ATP-grasp fold, RimK-type; Phosphoribosylaminoimidazole carboxylase
CL 2.3.8 Ribosomal proteins GO:0003735
EC
GO InterPro
Biological Process: protein modification process (GO:0006464)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [HJ] Coenzyme transport and metabolism;Translation, ribosomal structure and biogenesis;
CC MODEL: acur
CC STATUS: curated by pieretti (20100412)
MW 31587 Da
SQ 295 aa
 
........10........20........30........40........50
| | | | |
MKIAILSRNSKLYSTRRLIEAGRKRGHTVRILDPLRCYMRIAADGFSLHY
KGKPITGFDAVIPRIGASVTRYATAVLRQLEFMGTYTPNPSDAILRSRDK
LRAHQLLAAQGIDMPVTVFGDNPDDTQDLLSMLGPPPHVVKLNEGAQGAG
VILTEKASASRGVVEALRGLYANFIVQEFIGEAEGADLRCFVVGDKVVAA
MRRQAAEGDFRSNLHLGGTAAVAEATEQEQEVAVRSARALGLAVAGVDLI
RSTRGPLVLEVNSTPGLEGVEGVCGVDVAAAIVLHLEQSVRRLPG
X.species

YP_365098.1 lcl|rimK-XCV3367

1

295

S=1411 I=93 E=5.29382e-164

ribosomal protein S6 modification protein

X.species

NP_638455.1 lcl|rimK-XCC3108

1

291

S=1369 I=90 E=8.15231e-159

ribosomal protein S6 modification protein

X.species

lcl|rimK-XALc_0660

1

287

S=1207 I=80 E=3.29461e-139

probable ribosomal protein s6 modification protein

X.species

NP_643561.1 lcl|rimK-XAC3253

1

246

S=1166 I=91 E=2.95496e-134

ribosomal protein S6 modification protein

X.species

NP_643560.1 lcl|rimK-XAC3252

244

295

S=228 I=90 E=1.19416e-20

ribosomal protein S6 modification protein

pubmed

1

288

S=827 I=55 E=1.21294e-91

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

Pubmed 2570347

 

prodomImg

pubmed

1

152

S=296 I=41 E=2.79802e-27

Ribosomal protein S6 modification protein

Pubmed 10400597

 

prodomImg

pubmed

1

292

S=265 I=34 E=1.45015e-23

Orf5

Pubmed 16109948,16332881

 

prodomImg

pubmed

1

291

S=239 I=32 E=1.99722e-20

Orf5 ; ATP-binding Manganese Metal-binding Nucleotide-binding

Pubmed 16109948,16332881

 

prodomImg

pubmed

45

291

S=236 I=30 E=4.81795e-20

Tetrahydromethanopterin:alpha-L-glutamate ligase EC=6.3.2.- ; ATP-binding GTP-binding Manganese Metal-binding Nucleotide-binding

Pubmed 12909715

 

prodomImg

pubmed

89

288

S=235 I=35 E=6.65216e-20

Conserved protein ; ATP-binding Manganese Metal-binding Nucleotide-binding

Pubmed 15014146

 

prodomImg

pubmed

76

279

S=187 I=33 E=5.05132e-14

Conserved protein

Pubmed 15014146

 

prodomImg

pubmed

13

286

S=180 I=31 E=3.04386e-13

Putative tetrahydromethanopterin biosynthesis protein

Pubmed 10482517

 

prodomImg

pubmed

13

294

S=174 I=27 E=1.89929e-12

Putative tetrahydromethanopterin biosynthesis protein ; ATP-binding Manganese Metal-binding Nucleotide-binding

Pubmed 10482517

 

prodomImg

pubmed

39

282

S=173 I=29 E=2.07232e-12

Ribosomal protein S6 modification-like protein B ; Alternative splicing ATP-binding Manganese Metal-binding Nucleotide-binding

Pubmed 10574462

 

prodomImg

sp

1

295

S=1411 I=93 E=1.35975e-162

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

 

prodomImg

sp

1

295

S=1410 I=93 E=1.87741e-162

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

 

prodomImg

sp

1

292

S=1386 I=92 E=1.65752e-159

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

 

prodomImg

sp

1

292

S=1386 I=92 E=1.65752e-159

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

 

prodomImg

sp

1

291

S=1369 I=90 E=2.09397e-157

Ribosomal protein S6 modification protein ; ATP-binding Magnesium Manganese Metal-binding Nucleotide-binding biosynthesis

 

prodomImg

Iprscan IPR013816 [G3DSA:3.30.470.20]

160

277

ATP-grasp fold, subdomain 2

Iprscan [MF_01552]

1

295

-

Iprscan [PTHR21621]

1

282

-

Iprscan IPR013651 [PF08443]

98

283

ATP-grasp fold, RimK-type

Iprscan IPR004666 [TIGR00768]

2

286

S6 modification enzyme RimK

Iprscan IPR011761 [PS50975]

104

287

ATP-grasp fold

Iprscan [seg]

219

234

-

PD282530

108

288

S=381 I=49 E=1.09956e-38

PD037405

1

107

S=368 I=70 E=3.92361e-37

PDA1L5J9

108

164

S=275 I=91 E=8.82323e-26

PDA2N6Z1

185

279

S=171 I=35 E=2.90946e-13

PD816972

68

290

S=139 I=23 E=2.17474e-09

PDA24484

115

218

S=116 I=38 E=1.50413e-06

PDA4S663

108

184

S=110 I=30 E=8.23484e-06

PD861477

137

268

S=105 I=31 E=3.68921e-05

Iprscan [SSF56059]

98

291

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one g9FCcDOs)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

172 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB23WJU3/XFF4834R_chr13840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB23WJU3/XFF4834R_chr13840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB23WJU3/XFF4834R_chr13840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB23WJU3/XFF4834R_chr13840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.