Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13730XFF4834R_chr14590329_1572640_r3_XFF4834R-XFF4834R_chr13730XFF4834R_chr13730hypothetical protein

XFF4834R_chr14590329_1572640_r3_XFF4834R-XFF4834R_chr13730 XFF4834R_chr13730
XFF4834R_chr13720
XFF4834R_chr13720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13740
XFF4834R_chr13740
ID XFF4834R_chr14590329_1572640_r3_XFF4834R-XFF4834R_chr13730
AC XFF4834R_chr13730
LT XFF4834R_chr13730
OR XFF4834R_chr from 1572329 to 1572640 on strand -
DE hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN les 3 premiers hits tblastx de ncbi ont de bons scores pour conserverd hypothetical prot hit1 : I=57% ; max score =166 ; E=10-38 ; PCQ=100% pour conserved hypothetical prot
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20100713)
MW 11210.6 Da
SQ 103 aa
 
........10........20........30........40........50
| | | | |
MRNARLAVVGMLIVFLAGCSGGGPSKDQRQRAFLQYMKEEGSDNAKIRDF
ESSKCTKSESAPAYACDVSAKVQAAEHDFGNELDGIYTFAEVGGNWKVTG
RIR
X.species

NP_641833.1 lcl|XAC1500-XAC1500

1

103

S=330 I=55 E=1.08482e-33

hypothetical protein

X.species

YP_362843.1 lcl|XCV1112

1

72

S=118 I=35 E=5.1932e-08

putative secreted protein

X.species

NP_636972.1 lcl|XCC1602

1

72

S=112 I=31 E=2.72189e-07

hypothetical protein

X.species

NP_643598.1 lcl|XAC3290-XAC3290

1

68

S=97 I=31 E=1.5689e-05

hypothetical protein

pubmed

1

72

S=118 I=35 E=1.49438e-06

Putative uncharacterized protein

Pubmed 17488332

 

prodomImg

Iprscan [PS51257]

1

19

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [tmhmm]

7

24

-

PD655404

1

103

S=355 I=57 E=1.6492e-35

PD687946

1

72

S=105 I=30 E=2.85959e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nWWBUQe7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjfIcjE/XFF4834R_chr13730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjfIcjE/XFF4834R_chr13730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjfIcjE/XFF4834R_chr13730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjfIcjE/XFF4834R_chr13730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.