Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13650XFF4834R_chr14560943_1568113_f2_acur-XFF4834R_chr13650XFF4834R_chr13650Hypothetical protein

XFF4834R_chr14560943_1568113_f2_acur-XFF4834R_chr13650 XFF4834R_chr13650
XFF4834R_chr_1472
XFF4834R_chr_1472
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13660
XFF4834R_chr13660
ID XFF4834R_chr14560943_1568113_f2_acur-XFF4834R_chr13650
AC XFF4834R_chr13650
LT XFF4834R_chr13650
OR XFF4834R_chr from 1567943 to 1568113 on strand +
DE Hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN tBlastx de NCBI : I=84% ; S =100 ; E=6 10 -20 et 98% coverage pour hypothetical protein de Halella chejuensis et 0 hit interpro
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by darrasse (20110822)
MW 6200 Da
SQ 56 aa
 
........10........20........30........40........50
| | | | |
MATNPPKGDGHRNGAVRNRSQTQTPAGNFVKRDTSTGRFMDVKADKLPFK
GVRKEK
Show or not Domain decomposition
 

PDA153O3

1

56

S=153 I=56 E=4.69978e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EYwDyOCU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUscwS8/XFF4834R_chr13650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUscwS8/XFF4834R_chr13650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUscwS8/XFF4834R_chr13650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUscwS8/XFF4834R_chr13650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.