Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13210cysNXFF4834R_chr13210sulfate adenylyltransferase, subunit 1

cysN XFF4834R_chr13210
XFF4834R_chr13200
XFF4834R_chr13200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1422
XFF4834R_chr_1422
ID cysN
AC XFF4834R_chr13210
LT XFF4834R_chr13210
OR XFF4834R_chr from 1506602 to 1508578 on strand +
DE sulfate adenylyltransferase, subunit 1
IP Adenylylsulphate kinase, C-terminal; Translation elongation/initiation factor/Ribosomal, beta-barrel; Sulphate adenylyltransferase, large subunit
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: sulfate assimilation (GO:0000103)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: GTP binding (GO:0005525)
Molecular Function: GTPase activity (GO:0003924)
Molecular Function: kinase activity (GO:0016301)
transferring phosphorus-containing groups (GO:0016772)

Curated
PM
AN highly similar to raxQ from X. oryzae pv. oryzae
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 71786.4 Da
SQ 658 aa
 
........10........20........30........40........50
| | | | |
MGSDSGFGIRDWQEQPAASGKVEGSALANPQSPLPNPGTIGAYLQQHESK
PLLRFITCGSVDDGKSTLIGRLLYDSKRLFDDQLAALENDSRRHGTQGGG
IDYALLMDGLAAEREQGITIDVAYRYFDTDRRKFIVADCPGHAQYTRNMA
TGASTADVAVVLVDARKGLLTQTRRHSYIVSLLGIRHVVLAVNKMDLVDY
DAQVFADIAEGYAALAAQLGIDQVQCIPLSALAGENLSSASTRMPWYSGP
HLLQHLDTVQLEPPDAASGLRLPVQWVNRPNAQFRGYAGTIAAGQVQVGD
AVVVVPSGRRTQVASVRDANGEVSSARAGQAVTLTLRDEIDISRGDIIAA
IDDPPEVADQFAAHLLWMDDAALLPGRPYWLKIGTRTVTVSISDIKHKVD
VNTQERLAAKRLELNEVGYCNLALDEPIAFSPYARNRVLGGFILIDRQSN
ATVAAGTLEFALRRAGNVHWQHLDVDRGARARIKGQAPRVLWFTGLSGAG
KSTVANLVDKRLHALGYHTFILDGDNVRHGLNRDLGFTDEDRVENIRRVA
EVARLMADAGLIVLVSFISPFRAERQLARERFDQGEFVEVFVDVPLAVAE
ARDVKGLYRKARAGQIPNFTGIDSPYEAPQTPEIHLHADGENVEALAHHV
LEYLGLER
XFF4834R

XFF4834R_chr09760 lcl|tufB-XFF4834R_chr09760

49

205

S=201 I=32 E=1.61627e-17

protein chain elongation factor EF-Tu (duplicate of tufA)

XFF4834R

XFF4834R_chr09630 lcl|tufB-XFF4834R_chr09630

49

205

S=201 I=32 E=1.61627e-17

protein chain elongation factor EF-Tu (duplicate of tufA)

XFF4834R

XFF4834R_chr31790 lcl|lepA-XFF4834R_chr31790

104

237

S=116 I=29 E=3.0823e-07

GTP-binding membrane protein

XFF4834R

XFF4834R_chr26830 lcl|XFF4834R_chr29350520_3098234_r2_XFF4834R-XFF4834R_chr26830

117

239

S=111 I=29 E=1.49359e-06

XFF4834R

XFF4834R_chr10100 lcl|typA-XFF4834R_chr10100

106

196

S=109 I=32 E=2.32994e-06

GTP-binding protein

X.species

NP_643635.1 lcl|nodQ-XAC3328

1

658

S=3173 I=93 E=0

bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein

X.species

YP_365176.1 lcl|cysN-XCV3445

1

658

S=3147 I=92 E=0

bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein

X.species

NP_638517.1 lcl|nodQ-XCC3171

1

658

S=3052 I=88 E=0

bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein

X.species

lcl|CysN-XALc_2296

40

654

S=2597 I=80 E=0

putative sulfate adenylyltransferase, atp sulfurylase protein

X.species

lcl|tuf-XALc_0512

49

205

S=202 I=32 E=4.44088e-17

probable elongation factor tu protein

X.species

lcl|tuf-XALc_0499

49

205

S=202 I=32 E=4.44088e-17

probable elongation factor tu (ef-tu) protein

X.species

YP_362727.1 lcl|tuf-XCV0996

49

205

S=201 I=32 E=6.18524e-17

elongation factor Tu

X.species

YP_362715.1 lcl|tuf-XCV0984

49

205

S=201 I=32 E=6.18524e-17

elongation factor Tu

X.species

NP_641317.1 lcl|tuf-XAC0970

49

205

S=201 I=32 E=6.18524e-17

elongation factor Tu

X.species

NP_641305.1 lcl|tuf-XAC0957

49

205

S=201 I=32 E=6.18524e-17

elongation factor Tu

X.species

NP_636279.1 lcl|tuf-XCC0893

107

205

S=194 I=38 E=4.55477e-16

elongation factor Tu

X.species

NP_636267.1 lcl|tuf-XCC0880

107

205

S=194 I=38 E=4.63489e-16

elongation factor Tu

X.species

lcl|lepA-XALc_2544

104

237

S=128 I=31 E=4.07499e-08

probable gtp-binding protein lepa

X.species

NP_636644.1 lcl|lepA-XCC1270

104

237

S=124 I=30 E=1.34548e-07

GTP-binding protein LepA

X.species

YP_363104.1 lcl|lepA-XCV1373

104

237

S=116 I=29 E=1.10972e-06

GTP-binding protein LepA

X.species

NP_641657.1 lcl|lepA-XAC1322

104

237

S=116 I=29 E=1.12924e-06

GTP-binding protein LepA

X.species

YP_364568.1 lcl|infB-XCV2837

117

239

S=112 I=29 E=3.96316e-06

translation initiation factor IF-2

X.species

NP_636312.2 lcl|typA-XCC0926

106

263

S=111 I=28 E=4.92838e-06

GTP-binding elongation factor protein

X.species

NP_642998.1 lcl|infB-XAC2687

117

239

S=111 I=29 E=5.19306e-06

translation initiation factor IF-2

X.species

lcl|typA-XALc_0544

106

263

S=110 I=28 E=6.92434e-06

probable gtp-binding elongation factor protein

X.species

NP_637861.1 lcl|infB-XCC2511

117

239

S=109 I=29 E=8.10094e-06

translation initiation factor IF-2

X.species

NP_641351.1 lcl|typA-XAC1004

106

196

S=109 I=32 E=9.15264e-06

GTP-binding elongation factor protein

X.species

YP_362763.1 lcl|typA-XCV1032

106

196

S=109 I=32 E=9.23279e-06

GTP-binding elongation factor protein

X.species

lcl|infB-XALc_1016

117

239

S=102 I=29 E=5.61228e-05

probable translation initiation factor if-2 protein

pubmed

1

658

S=3215 I=93 E=0

RaxQ ; ATP-binding GTP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 11967067

 

prodomImg

pubmed

37

658

S=1920 I=58 E=0

Bifunctional enzyme nodQ EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nodulation Nucleotide-binding Nucleotidyltransferase

Pubmed 9421916

 

prodomImg

pubmed

37

654

S=1913 I=58 E=0

Bifunctional enzyme nodQ EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nodulation Nucleotide-binding Nucleotidyltransfera

Pubmed 2546009,2520820

 

prodomImg

pubmed

27

652

S=1885 I=58 E=0

Sulfate adenylate transferase subunit 1 ; ATP-binding GTP-binding Nucleotide-binding Nucleotidyltransferase Plasmid

Pubmed 16672515

 

prodomImg

pubmed

37

654

S=1872 I=58 E=0

NodQ2 ATP sulfurylase large subunit protein ; ATP-binding GTP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 12676676,7986038

 

prodomImg

sp

39

657

S=2381 I=74 E=0

Bifunctional enzyme cysN/cysC EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

39

657

S=2377 I=74 E=0

Bifunctional enzyme cysN/cysC EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

31

654

S=1932 I=59 E=0

Bifunctional enzyme nodQ EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nodulation Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

37

658

S=1920 I=58 E=0

Bifunctional enzyme nodQ EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nodulation Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

37

654

S=1913 I=58 E=0

Bifunctional enzyme nodQ EC=2.7.7.4 EC=2.7.1.25 ; ATP-binding GTP-binding Kinase Multifunctional Nodulation Nucleotide-binding Nucleotidyltransfera

 

prodomImg

Iprscan IPR000795 [PR00315]

54

67

Protein synthesis factor, GTP-binding

Iprscan IPR000795 [PR00315]

115

123

Protein synthesis factor, GTP-binding

Iprscan IPR000795 [PR00315]

135

145

Protein synthesis factor, GTP-binding

Iprscan IPR000795 [PR00315]

151

162

Protein synthesis factor, GTP-binding

Iprscan IPR000795 [PR00315]

188

197

Protein synthesis factor, GTP-binding

Iprscan [G3DSA:3.40.50.300]

43

247

-

Iprscan [G3DSA:2.40.30.10]

265

385

-

Iprscan [G3DSA:3.40.50.300]

464

654

-

Iprscan [MF_00062]

44

487

-

Iprscan IPR002891 [MF_00065]

486

658

Adenylylsulphate kinase, C-terminal

Iprscan [PTHR23115:SF34]

44

379

-

Iprscan [PTHR23115]

44

379

-

Iprscan IPR002891 [PF01583]

489

641

Adenylylsulphate kinase, C-terminal

Iprscan IPR000795 [PF00009]

52

254

Protein synthesis factor, GTP-binding

Iprscan IPR004161 [PF03144]

289

348

Translation elongation factor EFTu/EF1A, domain 2

Iprscan IPR011779 [TIGR02034]

53

458

Sulphate adenylyltransferase, large subunit

Iprscan IPR002891 [TIGR00455]

470

654

Adenylylsulphate kinase, C-terminal

Iprscan IPR000795 [PS00301]

108

123

Protein synthesis factor, GTP-binding

Iprscan [seg]

292

305

-

PD002350

475

654

S=631 I=62 E=7.29399e-69

PDA5Q5D8

470

590

S=200 I=37 E=1.29702e-16

PDA1F7X5

81

131

S=183 I=67 E=1.56865e-14

PD007412

412

462

S=179 I=67 E=5.13441e-14

PD687047

1

51

S=176 I=69 E=9.28908e-14

PDA8J6C0

284

411

S=171 I=32 E=4.01889e-13

PD975872

270

403

S=170 I=28 E=4.91129e-13

PDA5S6H6

124

218

S=157 I=33 E=1.92892e-11

PDA8N085

490

610

S=155 I=29 E=3.55115e-11

PD862703

357

411

S=151 I=53 E=1.27934e-10

Iprscan [SSF52540]

47

277

-

Iprscan [SSF52540]

483

654

-

Iprscan IPR009000 [SSF50447]

262

357

Translation elongation/initiation factor/Ribosomal, beta-barrel

Iprscan IPR009001 [SSF50465]

358

463

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rqMnxZTS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

23 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKd2v22/XFF4834R_chr13210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKd2v22/XFF4834R_chr13210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKd2v22/XFF4834R_chr13210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKd2v22/XFF4834R_chr13210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.