Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13200cysDXFF4834R_chr13200sulfate adenylyltransferase subunit 2

cysD XFF4834R_chr13200
XFF4834R_chr13190
XFF4834R_chr13190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13210
XFF4834R_chr13210
ID cysD
AC XFF4834R_chr13200
LT XFF4834R_chr13200
OR XFF4834R_chr from 1505694 to 1506602 on strand +
DE sulfate adenylyltransferase subunit 2
IP Sulphate adenylyltransferase, small subunit
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: sulfate reduction (GO:0019419)
Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)
Molecular Function: sulfate adenylyltransferase (ATP) activity (GO:0004781)

Curated
PM
AN highly similar to raxP from X. oryzae pv. oryzae
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 34175.9 Da
SQ 302 aa
 
........10........20........30........40........50
| | | | |
MTLPPLSHLDRLEAESIHILREVAAEFRVPVMLYSVGKDSSVLLHLLLKA
FAPSRPPIPLLHIDTRWKFREMIAFRDRRAAETGVDLRVHINPDGVVQDV
GPISHGAAVHTDIMKTQGLKQALEHGGFDAAIGGARRDEEKSRAKERVFS
FRTARHRWDPKNQRPELWNLYNARTGPGESVRVFPLSNWTELDIWLYIYR
ERIPVVPLYLAAPRPVVERDGAWIMVDDARLPLHPGETPQLRSVRFRTLG
CYPLTGAIDSNADTLEAVIAEMLVSTSSERQGRMIDHAPGASMEQKKLEG
YF
X.species

NP_643636.1 lcl|cysD-XAC3329

1

302

S=1578 I=99 E=0

sulfate adenylyltransferase subunit 2

X.species

YP_365177.1 lcl|cysD-XCV3446

1

302

S=1563 I=98 E=0

sulfate adenylyltransferase subunit 2

X.species

NP_638518.1 lcl|cysD-XCC3172

1

302

S=1521 I=95 E=2.84835e-177

sulfate adenylyltransferase subunit 2

X.species

lcl|XALc_2297

1

302

S=1254 I=81 E=5.81889e-145

putative sulfate adenylyltransferase protein

pubmed

1

302

S=1536 I=96 E=1.74338e-177

ATP sulfurylase small subunit RaxP ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 11967067

 

prodomImg

pubmed

6

302

S=1166 I=70 E=1.33852e-132

Putative small subunit ATP sulfurylase ; ATP-binding Nucleotide-binding Nucleotidyltransferase Plasmid

Pubmed 12673061

 

prodomImg

pubmed

6

302

S=1093 I=65 E=8.22435e-124

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 9611812

 

prodomImg

pubmed

6

302

S=1084 I=68 E=1.05815e-122

ATP sulfurylase D subunit ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 11114933

 

prodomImg

pubmed

6

302

S=1080 I=68 E=3.01251e-122

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

Pubmed 1316900

 

prodomImg

sp

1

302

S=1578 I=99 E=0

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

302

S=1563 I=98 E=0

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

302

S=1536 I=96 E=1.19831e-177

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

302

S=1536 I=96 E=1.19831e-177

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

302

S=1521 I=95 E=8.08072e-176

Sulfate adenylyltransferase subunit 2 EC=2.7.7.4 ; ATP-binding Nucleotide-binding Nucleotidyltransferase

 

prodomImg

Iprscan IPR014729 [G3DSA:3.40.50.620]

13

209

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [MF_00064]

4

302

-

Iprscan IPR011784 [PIRSF002936]

6

302

Sulphate adenylyltransferase, small subunit

Iprscan IPR002500 [PF01507]

30

257

Phosphoadenosine phosphosulphate reductase

Iprscan IPR011784 [TIGR02039]

9

302

Sulphate adenylyltransferase, small subunit

PD867396

86

179

S=370 I=73 E=2.27682e-37

PD002993

7

87

S=223 I=56 E=1.2837e-19

PD006993

251

301

S=174 I=67 E=1.1207e-13

PD002340

181

211

S=149 I=81 E=1.28525e-10

PDA1S917

79

107

S=144 I=97 E=5.14093e-10

PDA1F945

215

250

S=132 I=72 E=1.63789e-08

PDA1H947

86

114

S=103 I=59 E=5.20956e-05

Iprscan [SSF52402]

8

253

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Iajl8buP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

221 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHo_EBu/XFF4834R_chr13200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHo_EBu/XFF4834R_chr13200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHo_EBu/XFF4834R_chr13200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHo_EBu/XFF4834R_chr13200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.