Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13190cysJXFF4834R_chr13190sulfite reductase (NADPH) alpha subunit

cysJ XFF4834R_chr13190
XFF4834R_chr13180
XFF4834R_chr13180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13200
XFF4834R_chr13200
ID cysJ
AC XFF4834R_chr13190
LT XFF4834R_chr13190
OR XFF4834R_chr from 1503667 to 1505514 on strand -
DE sulfite reductase (NADPH) alpha subunit
IP Flavodoxin/nitric oxide synthase; Sulphite reductase [NADPH] flavoprotein, alpha chain; Ferredoxin--NADP reductase; Riboflavin synthase-like beta-barrel
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: sulfate assimilation (GO:0000103)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cysteine biosynthetic process (GO:0019344)
Molecular Function: sulfite reductase (NADPH) activity (GO:0004783)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: FMN binding (GO:0010181)
Molecular Function: iron ion binding (GO:0005506)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100709)
MW 66452.2 Da
SQ 615 aa
 
........10........20........30........40........50
| | | | |
MTAASSTLAPSPLPDERKVLLDRLVDGLDTASLWWLSGYAAGLAQGHPPR
SLAVLPGGQAHALAQEGQRLTVVYGSQTGNARREAEHLAAEAEAAGLSVR
LVRADAYPTRELASERLLYVVISTQGEGDPPDDAIGLVEFLTSRRAPKVP
ELKYAVLGLGDSSYADFCGIARRIDERLAELGGSRVQPRGEADLDIDSVA
VPWRAQALTRARAQLKGGLHSATVTPLRSSPATPVWSHQQPFAAELLSNQ
IISGRDFKGPGFRVYAAPGKRVRHLEFSLQGSGLSYEPGDALGIRHRNPP
ALVDAVLQTLRLDGDAAVTVGEQTLALHAWLATQRELTKLSRPFLTAHAE
RAGAQELQALLDPTQTAGLASLLADHQVIDVLRRWPADWDHAGLLAALRP
LTPRLYSIASSRKRVGDEVHLAVDEVTYQAHGHAHLGAASGFLAALGEGD
TAPVYIEPNERFRVPADADRDILMIGPGTGVAPFRGFVQERAETGAKGRN
WLFFGAQHFNTDFLYQAEWQQALQRGELHALDLAFSRDQAEKLYVQHRLR
ARGAEVYAWLQGGAHVYVCGAISMGKDVHAALLEIVASHGALDAEAASAY
LTQLQVEGRYARDVY
XFF4834R

XFF4834R_chr39020 lcl|XFF4834R_chr42170865_4495465_r3_XFF4834R-XFF4834R_chr39020

472

615

S=237 I=40 E=6.39251e-22

XFF4834R

XFF4834R_chr39020 lcl|XFF4834R_chr42170865_4495465_r3_XFF4834R-XFF4834R_chr39020

72

178

S=150 I=35 E=2.47024e-11

XFF4834R

XFF4834R_chr16910 lcl|XFF4834R_chr18100439_1943187_r1_XFF4834R-XFF4834R_chr16910

456

615

S=214 I=41 E=3.61793e-19

XFF4834R

XFF4834R_chr16910 lcl|XFF4834R_chr18100439_1943187_r1_XFF4834R-XFF4834R_chr16910

66

193

S=169 I=32 E=1.06212e-13

X.species

NP_643637.1 lcl|cysJ-XAC3330

1

615

S=2714 I=88 E=0

NADPH-sulfite reductase flavoprotein subunit

X.species

YP_365178.1 lcl|cysJ-XCV3447

1

615

S=2651 I=86 E=0

NADPH-sulfite reductase flavoprotein subunit

X.species

NP_638519.1 lcl|cysJ-XCC3173

1

615

S=2464 I=80 E=0

NADPH-sulfite reductase flavoprotein subunit

X.species

NP_639294.1 lcl|piuB-XCC3955

472

615

S=250 I=43 E=6.06201e-23

iron-uptake factor

X.species

NP_639294.1 lcl|piuB-XCC3955

74

193

S=157 I=35 E=1.31648e-11

iron-uptake factor

X.species

NP_644335.2 lcl|piuB-XAC4036

472

615

S=232 I=40 E=1.01227e-20

iron-uptake factor

X.species

NP_644335.2 lcl|piuB-XAC4036

59

201

S=157 I=32 E=1.38718e-11

iron-uptake factor

X.species

YP_365859.1 lcl|XCV4128

472

615

S=230 I=39 E=2.01572e-20

Iron uptake factor (C-terminal fragment)

X.species

YP_365859.1 lcl|XCV4128

72

201

S=159 I=33 E=6.66907e-12

Iron uptake factor (C-terminal fragment)

X.species

lcl|XALc_2995

472

615

S=226 I=43 E=5.07924e-20

hypothetical iron-uptake factor protein

X.species

lcl|XALc_2995

96

193

S=144 I=41 E=4.38115e-10

hypothetical iron-uptake factor protein

X.species

NP_643257.2 lcl|XAC2948-XAC2948

456

615

S=177 I=38 E=4.5123e-14

sulfite reductase

X.species

NP_643257.2 lcl|XAC2948-XAC2948

70

193

S=164 I=31 E=1.93367e-12

sulfite reductase

X.species

YP_364823.1 lcl|XCV3092

456

615

S=172 I=38 E=1.8049e-13

sulfite reductase (NADPH)

X.species

YP_364823.1 lcl|XCV3092

70

193

S=166 I=32 E=1.09713e-12

sulfite reductase (NADPH)

X.species

NP_638127.1 lcl|XCC2779

456

615

S=156 I=40 E=1.6952e-11

sulfite reductase

X.species

NP_638127.1 lcl|XCC2779

70

193

S=152 I=31 E=5.22012e-11

sulfite reductase

pubmed

1

615

S=2643 I=84 E=0

Sulfite reductase flavoprotein ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN NADP Oxidoreductase

Pubmed 11967067

 

prodomImg

pubmed

11

615

S=1041 I=38 E=4.1839e-117

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 11445163

 

prodomImg

pubmed

1

615

S=981 I=38 E=7.86064e-110

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 2550423

 

prodomImg

pubmed

1

615

S=981 I=39 E=8.42849e-110

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

Pubmed 2550423

 

prodomImg

pubmed

70

615

S=972 I=40 E=9.18866e-109

Sulfite reductase subunit II ; Amino-acid biosynthesis Cysteine Electron transport FAD Flavoprotein FMN NADP Oxidoreductase

Pubmed 16885444

 

prodomImg

sp

11

615

S=1046 I=40 E=6.29801e-118

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

 

prodomImg

sp

11

615

S=1045 I=40 E=8.62021e-118

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

 

prodomImg

sp

11

615

S=1041 I=38 E=2.84622e-117

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

 

prodomImg

sp

6

615

S=1035 I=39 E=1.67082e-116

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

 

prodomImg

sp

11

615

S=1030 I=38 E=5.51672e-116

Sulfite reductase [NADPH] flavoprotein alpha-component EC=1.8.1.2 ; Amino-acid biosynthesis Cysteine Electron transport FAD FMN Oxidoreductase

 

prodomImg

Iprscan IPR001709 [PR00371]

286

296

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

404

411

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

473

492

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

498

507

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

511

522

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

542

558

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001709 [PR00371]

565

573

Flavoprotein pyridine nucleotide cytochrome reductase

Iprscan IPR001094 [PR00369]

71

84

Flavodoxin-like

Iprscan IPR001094 [PR00369]

119

130

Flavodoxin-like

Iprscan IPR001094 [PR00369]

151

161

Flavodoxin-like

Iprscan IPR001094 [PR00369]

175

194

Flavodoxin-like

Iprscan [G3DSA:3.40.50.360]

67

217

-

Iprscan [G3DSA:1.20.990.10]

296

402

-

Iprscan [G3DSA:3.40.50.80]

463

615

-

Iprscan [PTHR19384:SF18]

107

615

-

Iprscan [PTHR19384]

107

615

-

Iprscan IPR008254 [PF00258]

72

195

Flavodoxin/nitric oxide synthase

Iprscan IPR003097 [PF00667]

269

442

FAD-binding, type 1

Iprscan IPR001433 [PF00175]

474

579

Oxidoreductase FAD/NAD(P)-binding

Iprscan IPR010199 [TIGR01931]

8

615

Sulphite reductase [NADPH] flavoprotein, alpha chain

Iprscan IPR008254 [PS50902]

70

208

Flavodoxin/nitric oxide synthase

Iprscan IPR017927 [PS51384]

239

465

Ferredoxin reductase-type FAD-binding domain

Iprscan [seg]

81

95

-

Iprscan [seg]

204

215

-

Iprscan [seg]

394

405

-

Iprscan [seg]

430

449

-

PD000183

472

615

S=338 I=52 E=2.62162e-33

PD266648

1

71

S=292 I=80 E=9.82438e-28

PDA1K3Y4

187

257

S=260 I=72 E=5.85397e-24

PD819349

121

188

S=192 I=51 E=1.2308e-15

PD610387

132

191

S=142 I=51 E=1.33622e-09

PDA2V9T2

450

473

S=126 I=100 E=1.15022e-07

PD037069

236

300

S=118 I=44 E=1.06253e-06

PDA621R0

451

473

S=114 I=91 E=3.44762e-06

PDA658K4

450

472

S=104 I=83 E=4.92496e-05

Iprscan IPR017938 [SSF63380]

231

463

Riboflavin synthase-like beta-barrel

Iprscan [SSF52343]

461

615

-

Iprscan [SSF52218]

53

223

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one L6oeA9De)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

327 hits
swiss-prot

Swiss-Prot ncbi-blastp

210 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

29 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRJY8UY/XFF4834R_chr13190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRJY8UY/XFF4834R_chr13190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRJY8UY/XFF4834R_chr13190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRJY8UY/XFF4834R_chr13190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.