Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13180cysIXFF4834R_chr13180sulfite reductase (NADPH) beta subunit, heme component

cysI XFF4834R_chr13180
XFF4834R_chr13170
XFF4834R_chr13170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13190
XFF4834R_chr13190
ID cysI
AC XFF4834R_chr13180
LT XFF4834R_chr13180
OR XFF4834R_chr from 1501837 to 1503543 on strand -
DE sulfite reductase (NADPH) beta subunit, heme component
IP Sulphite reductase (NADPH) hemoprotein, beta subunit
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Cellular Component: sulfite reductase complex (NADPH) (GO:0009337)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: heme binding (GO:0020037)
Molecular Function: sulfite reductase (NADPH) activity (GO:0004783)
Molecular Function: iron-sulfur cluster binding (GO:0051536)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100709)
MW 62489.9 Da
SQ 568 aa
 
........10........20........30........40........50
| | | | |
MSHSVEDIKSESRRLRGSLEQSLADAVTGALREDDQTLIKYHGSYQQDDR
DIRDERRRQKLEPAYQFMIRTRTPGGVITPTQWLALDGIATRYANHSLRI
TTRQAFQFHGVIKRELKATMQAINATLIDTLAACGDVNRNVQVAANPLLS
QAHATLYADAARVSEHLLPNTRAYYEIWLDEERVSGSGSEDEPIYGERYL
PRKFKIGFAAPPLNDVDVFANDLGFIAILRDGQLLGYNVSIGGGMGASHG
DAETWPRVANVIGFVTRDQLLDIATAVVTTQRDFGNRAVRKRARFKYTID
DHGLDTIVAEIARRAGFALQPAQPFAFDHNGDRYGWVEGEDGLWHLTLSL
PAGRIADTDTAAHLSGLRAIAQLNVGEFRMTPNQNLVIADVLASQRARVD
ALVAHYGLDAGNQSATALARGAMACVALPTCGLAMAEAERYLPDFSAALQ
PLLQQHGLAETPIVLRLSGCPNGCSRPYLAEIALVGKAPGRYNLMLGGDR
RGQRLNTLYRENITEPEILAALEPLLARYAAERDHANDEGFGDFLHRAGV
IALPPYPTHRRLDLELLA
X.species

NP_643638.1 lcl|cysI-XAC3331

1

568

S=2816 I=95 E=0

sulfite reductase subunit beta

X.species

YP_365179.1 lcl|cysI-XCV3448

1

568

S=2762 I=92 E=0

sulfite reductase subunit beta

X.species

NP_638520.1 lcl|cysI-XCC3174

1

568

S=2635 I=88 E=0

sulfite reductase subunit beta

pubmed

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

Pubmed 11967067

 

prodomImg

pubmed

5

551

S=1591 I=52 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

Pubmed 11445163

 

prodomImg

pubmed

5

551

S=1568 I=51 E=0

YvgQ ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding NADP Oxidoreductase

Pubmed 10972189

 

prodomImg

pubmed

6

552

S=1473 I=54 E=1.54829e-169

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

Pubmed 19440302

 

prodomImg

pubmed

3

551

S=1392 I=52 E=1.14152e-159

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidoredu

Pubmed 8695637

 

prodomImg

sp

1

568

S=2816 I=95 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

 

prodomImg

sp

1

568

S=2763 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

 

prodomImg

sp

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding

 

prodomImg

sp

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidored

 

prodomImg

sp

1

568

S=2745 I=92 E=0

Sulfite reductase [NADPH] hemoprotein beta-component EC=1.8.1.2 ; 4Fe-4S Amino-acid biosynthesis Cysteine Heme Iron Iron-sulfur Metal-binding Oxidoreductase

 

prodomImg

Iprscan IPR006066 [PR00397]

420

438

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan IPR006066 [PR00397]

468

486

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan [G3DSA:3.30.413.10]

135

328

-

Iprscan [G3DSA:3.30.413.10]

416

563

-

Iprscan IPR006067 [PF01077]

161

316

Nitrite/sulphite reductase 4Fe-4S domain

Iprscan IPR005117 [PF03460]

63

125

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR005117 [PF03460]

340

404

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR011786 [TIGR02041]

6

551

Sulphite reductase (NADPH) hemoprotein, beta subunit

Iprscan IPR006066 [PS00365]

468

484

Nitrite/sulphite reductase iron-sulphur/siroheam-binding site

Iprscan [seg]

46

59

-

Iprscan [seg]

515

527

-

PD392958

135

220

S=247 I=52 E=2.40981e-22

PD000955

423

482

S=167 I=54 E=1.13895e-12

PD386778

344

410

S=163 I=46 E=3.44659e-12

PD581155

335

423

S=145 I=36 E=5.70535e-10

PD013199

5

65

S=136 I=48 E=6.84598e-09

PD126478

67

135

S=129 I=44 E=4.5803e-08

PDA1I399

313

339

S=126 I=78 E=1.0395e-07

Iprscan [SSF56014]

135

333

-

Iprscan [SSF56014]

417

563

-

Iprscan IPR005117 [SSF55124]

334

413

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Iprscan IPR005117 [SSF55124]

68

131

Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one foirXwCg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

80 hits
swiss-prot

Swiss-Prot ncbi-blastp

192 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUVr7iV/XFF4834R_chr13180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUVr7iV/XFF4834R_chr13180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUVr7iV/XFF4834R_chr13180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUVr7iV/XFF4834R_chr13180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.