Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr13170cysHXFF4834R_chr13170phosphoadenosine phosphosulfate reductase

cysH XFF4834R_chr13170
XFF4834R_chr_4645
XFF4834R_chr_4645
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13180
XFF4834R_chr13180
ID cysH
AC XFF4834R_chr13170
LT XFF4834R_chr13170
OR XFF4834R_chr from 1501115 to 1501840 on strand -
DE phosphoadenosine phosphosulfate reductase
IP Phosphoadenosine phosphosulphate reductase CysH-type; Phosphoadenosine phosphosulphate reductase thioredoxin; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.8.2 Sulfur metabolism GO:0006790
EC
GO InterPro
Biological Process: cysteine biosynthetic process (GO:0019344)
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: phosphoadenylyl-sulfate reductase (thioredoxin) activity (GO:0004604)
Molecular Function: transferase activity (GO:0016740)
phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) (GO:0019379)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by koebnik (20101112)
MW 27679 Da
SQ 241 aa
 
........10........20........30........40........50
| | | | |
MTALPAASITSSAFDDLDALNAQLEGLRADQRVAWALQHGPQNAALSSSF
GAQSAVTLHLLSQQRPDIPVILIDTGYLFPETYRFADALTERLKLNLKVY
RPLVSRAWMEARHGRLWEQGMVGIDQYNNLRKVEPMRRALDELDVGTWFT
GLRRSQSGGRAQTPIVQKRGERYKISPIADWTDRDVWQYLQAHDLPYHPL
WEQGYVSIGDFHTTRRWEPGMREEDTRFFGLKRECGIHEDI
pubmed

1

241

S=1246 I=96 E=1.56535e-142

PAPS reductase ; Oxidoreductase

Pubmed 11967067

 

prodomImg

pubmed

21

239

S=809 I=67 E=1.43369e-89

PAPS reductase ; Oxidoreductase

Pubmed 16885444

 

prodomImg

pubmed

17

239

S=800 I=65 E=1.60442e-88

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 2670946

 

prodomImg

pubmed

21

239

S=798 I=65 E=3.39592e-88

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 2005873,2670946

 

prodomImg

pubmed

21

238

S=702 I=62 E=1.22284e-76

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 8695637

 

prodomImg

pubmed

17

238

S=603 I=55 E=1.18972e-64

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

Pubmed 1463852

 

prodomImg

pubmed

17

238

S=305 I=36 E=1.63625e-28

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Amino-acid biosynthesis Cysteine Methionine NADP Oxidoreductase

Pubmed 7770049

 

prodomImg

pubmed

17

238

S=304 I=37 E=2.20085e-28

3'-phosphoadenosine-5'-phosphosulfate reductase

Pubmed 11010912

 

prodomImg

pubmed

1

238

S=303 I=32 E=2.8094e-28

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Oxidoreductase

Pubmed 18043661

 

prodomImg

pubmed

15

239

S=298 I=35 E=1.30328e-27

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Amino-acid biosynthesis Cysteine Methionine NADP Oxidoreductase

Pubmed 2203779

 

prodomImg

sp

1

241

S=1273 I=99 E=6.25365e-146

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

 

prodomImg

sp

1

241

S=1272 I=99 E=8.41153e-146

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

 

prodomImg

sp

1

241

S=1259 I=98 E=2.94964e-144

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

 

prodomImg

sp

1

241

S=1259 I=98 E=2.94964e-144

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

 

prodomImg

sp

1

241

S=1208 I=93 E=4.1235e-138

Phosphoadenosine phosphosulfate reductase EC=1.8.4.8 ; Cytoplasm Oxidoreductase

 

prodomImg

Iprscan IPR014729 [G3DSA:3.40.50.620]

16

212

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR23293]

175

216

-

Iprscan IPR002500 [PF01507]

44

215

Phosphoadenosine phosphosulphate reductase

Iprscan IPR011800 [TIGR02057]

17

238

Phosphoadenosine phosphosulphate reductase thioredoxin

Iprscan IPR004511 [TIGR00434]

29

239

Phosphoadenosine phosphosulphate reductase CysH-type

PDA1F7G5

125

193

S=198 I=55 E=1.66e-16

PD858201

1

37

S=170 I=95 E=3.95977e-13

PD002993

10

97

S=159 I=41 E=8.97922e-12

PDA1G2R1

96

128

S=107 I=65 E=2.01005e-05

Iprscan [SSF52402]

16

212

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SWBrUkhs)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

38 hits
swiss-prot

Swiss-Prot ncbi-blastp

154 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXyDGQA/XFF4834R_chr13170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXyDGQA/XFF4834R_chr13170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXyDGQA/XFF4834R_chr13170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXyDGQA/XFF4834R_chr13170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.