Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr12270hemLXFF4834R_chr12270probable glutamate-1-semialdehyde aminotransferase

hemL XFF4834R_chr12270
XFF4834R_chr_1313
XFF4834R_chr_1313
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12280
XFF4834R_chr12280
ID hemL
AC XFF4834R_chr12270
LT XFF4834R_chr12270
OR XFF4834R_chr from 1391017 to 1392306 on strand -
DE probable glutamate-1-semialdehyde aminotransferase
IP Aminotransferase class-III; Pyridoxal phosphate-dependent transferase, major region, subdomain 1
CL 1.5.3.12 Heme, porphyrin GO:0006783 GO:0006779
EC
GO InterPro
1-aminomutase activity (GO:0042286)
Biological Process: tetrapyrrole biosynthetic process (GO:0033014)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: transaminase activity (GO:0008483)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100331)
MW 45043.8 Da
SQ 429 aa
 
........10........20........30........40........50
| | | | |
MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLFDVD
DNRYIDYVGSWGPMIAGHNHPAVREAVEQSIRNGLSFGAPCAAEVTMAQT
IARLVPSCEMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDS
FLVKAGSGMLTLGVPTSPGVPAGLSELTATLSFNDFEGATALFDEIGAEV
AAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVALG
GAQAHYGVTPDLTTFGKIIGGGMPVGAYGGRRDLMEQVAPAGPIYQAGTL
SGNPVAMAAGLAMLELVQEPGFHTRLSEATSMLCEGLEDAARAAGIAVTT
NQVGGMFGLFFTDDVVESYAQATACDITSFNRFFHAMLQRGVYLAPSAYE
AGFMSSAHDEAVIEATLAAAREAFADVAR
XFF4834R

XFF4834R_chr_4397 lcl|XFF4834R_chr_4780240_4781217_r1_XFF4834R-XFF4834R_chr_4397

6

272

S=408 I=40 E=8.84955e-43

XFF4834R

XFF4834R_chr24750 lcl|XFF4834R_chr27070293_2856645_f1_XFF4834R-XFF4834R_chr24750

24

325

S=210 I=30 E=7.67726e-19

XFF4834R

XFF4834R_chr12180 lcl|astC-XFF4834R_chr12180

40

277

S=179 I=27 E=4.948e-15

succinylornithine transaminase, PLP-dependent

XFF4834R

XFF4834R_chr15660 lcl|bioA-XFF4834R_chr15660

38

277

S=138 I=27 E=4.92739e-10

7,8-diaminopelargonic acid synthase, PLP-dependent

XFF4834R

XFF4834R_chr24610 lcl|XFF4834R_chr26890547_2839995_r1_XFF4834R-XFF4834R_chr24610

215

322

S=121 I=32 E=5.22874e-08

XFF4834R

XFF4834R_chr_4397 lcl|XFF4834R_chr_4780240_4781217_r1_XFF4834R-XFF4834R_chr_4397

6

272

S=408 I=40 E=8.84955e-43

XFF4834R

XFF4834R_chr24750 lcl|XFF4834R_chr27070293_2856645_f1_XFF4834R-XFF4834R_chr24750

24

325

S=210 I=30 E=7.67726e-19

XFF4834R

XFF4834R_chr12180 lcl|astC-XFF4834R_chr12180

40

277

S=179 I=27 E=4.948e-15

succinylornithine transaminase, PLP-dependent

X.species

NP_643727.1 lcl|hemL-XAC3420

1

409

S=2050 I=95 E=0

glutamate-1-semialdehyde aminotransferase

X.species

YP_365266.1 lcl|hemL-XCV3535

1

409

S=2044 I=95 E=0

glutamate-1-semialdehyde aminotransferase

X.species

NP_638618.1 lcl|hemL-XCC3272

1

409

S=1959 I=89 E=0

glutamate-1-semialdehyde aminotransferase

X.species

lcl|hemL-XALc_0777

1

409

S=1773 I=83 E=0

probable glutamate-1-semialdehyde 2,1-aminomutase protein

X.species

YP_366079.1 lcl|hemL-XCV4348

6

359

S=472 I=38 E=5.85477e-50

glutamate-1-semialdehyde 2,1-aminomutase

X.species

NP_644540.1 lcl|hemL-XAC4241

216

359

S=234 I=40 E=3.47665e-21

glutamate-1-semialdehyde aminotransferase

X.species

NP_644541.1 lcl|hemL-XAC4242

6

132

S=211 I=43 E=2.51173e-18

glutamate-1-semialdehyde 2,1-aminomutase

X.species

NP_642804.1 lcl|XAC2489-XAC2489

24

325

S=208 I=30 E=5.80065e-18

beta alanine--pyruvate transaminase

X.species

YP_364399.1 lcl|XCV2668

26

325

S=201 I=30 E=3.84723e-17

beta alanine--pyruvate transaminase

X.species

lcl|XALc_1971

24

277

S=201 I=30 E=3.91491e-17

putative aminotransferase class-III family protein

X.species

lcl|XALc_0846

38

353

S=187 I=26 E=1.76776e-15

putative transaminase protein

X.species

NP_638628.1 lcl|argD-XCC3282

40

338

S=180 I=26 E=1.40803e-14

bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein

X.species

YP_365275.1 lcl|argD-XCV3544

40

277

S=175 I=27 E=5.93452e-14

bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein

X.species

NP_643736.1 lcl|argD-XAC3429

40

277

S=175 I=27 E=5.98649e-14

bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein

X.species

lcl|argD-XALc_0776

36

277

S=170 I=26 E=2.11941e-13

probable acetylornithine transaminase protein

X.species

NP_637711.1 lcl|XCC2357

24

277

S=170 I=29 E=2.52316e-13

beta alanine--pyruvate transaminase

X.species

lcl|XALc_1052

34

337

S=155 I=26 E=1.65756e-11

putative aminotransferase protein

X.species

lcl|XALc_1784

214

342

S=153 I=30 E=2.8709e-11

putative aminotransferase_pyridoxal_phosphate protein

X.species

NP_638232.1 lcl|bioA-XCC2884

38

277

S=151 I=27 E=4.76031e-11

adenosylmethionine--8-amino-7-oxononanoatetransaminase

X.species

YP_364933.1 lcl|XCV3202

38

277

S=138 I=27 E=1.91917e-09

adenosylmethionine--8-amino-7-oxononanoate transaminase

X.species

NP_643377.1 lcl|bioA-XAC3068

42

277

S=129 I=27 E=2.16651e-08

adenosylmethionine--8-amino-7-oxononanoate transaminase

X.species

NP_637699.1 lcl|bioA-XCC2345

215

322

S=122 I=33 E=1.44951e-07

putative aminotransferase

X.species

YP_364386.1 lcl|XCV2655

215

322

S=122 I=33 E=1.65203e-07

putative aminotransferase

X.species

NP_642792.1 lcl|bioA-XAC2477

215

322

S=121 I=33 E=1.94967e-07

putative aminotransferase

X.species

lcl|XALc_2212

220

277

S=107 I=45 E=1.01216e-05

putativeadenosylmethionine--8-amino-7-oxononanoate aminotransferase protein

pubmed

1

409

S=2067 I=96 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 7763385

 

prodomImg

pubmed

4

408

S=1334 I=62 E=6.887e-153

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 1900346,8202364

 

prodomImg

pubmed

4

408

S=1332 I=62 E=1.43251e-152

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 2254275

 

prodomImg

pubmed

4

408

S=1328 I=61 E=4.15002e-152

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 7565600

 

prodomImg

pubmed

6

408

S=1258 I=59 E=1.23665e-143

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 19077236

 

prodomImg

pubmed

3

408

S=1229 I=56 E=4.64204e-140

HemL ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 16914272,17906152

 

prodomImg

pubmed

3

408

S=1224 I=56 E=1.85679e-139

Glutamate-1-semialdehyde 2,1-aminotransferase ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

Pubmed 17906152

 

prodomImg

pubmed

5

408

S=1185 I=56 E=8.96747e-135

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Chlorophyll biosynthesis Cytoplasm Isomerase Porphyrin Pyridoxal phosphate

Pubmed 1900346,1905724

 

prodomImg

pubmed

4

408

S=1163 I=53 E=3.80631e-132

Glutamate 1-semialdehyde 2,1-aminomutase ; Pyridoxal phosphate

Pubmed 12777624

 

prodomImg

pubmed

1

408

S=1154 I=54 E=4.52764e-131

Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic EC=5.4.3.8 ; Chlorophyll biosynthesis Isomerase Plastid Porphyrin Pyridoxal phosphate Trans

Pubmed 8278535,7706283

 

prodomImg

sp

1

409

S=2067 I=96 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

 

prodomImg

sp

1

409

S=2050 I=95 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

 

prodomImg

sp

1

409

S=2044 I=95 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

 

prodomImg

sp

1

409

S=1990 I=92 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

 

prodomImg

sp

1

409

S=1990 I=92 E=0

Glutamate-1-semialdehyde 2,1-aminomutase EC=5.4.3.8 ; Cytoplasm Isomerase Porphyrin biosynthesis Pyridoxal phosphate

 

prodomImg

Iprscan IPR015421 [G3DSA:3.40.640.10]

71

319

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan [PTHR11986:SF5]

23

427

-

Iprscan IPR005814 [PTHR11986]

23

427

Aminotransferase class-III

Iprscan IPR005814 [PF00202]

38

361

Aminotransferase class-III

Iprscan IPR004639 [TIGR00713]

5

427

Tetrapyrrole biosynthesis, glutamate-1-semialdehyde aminotransferase

Iprscan IPR005814 [PS00600]

236

272

Aminotransferase class-III

PD860221

1

62

S=200 I=60 E=1.04636e-16

PD002845

351

408

S=197 I=63 E=2.12026e-16

PD844068

115

146

S=146 I=84 E=3.68594e-10

PD594215

67

115

S=142 I=55 E=9.53406e-10

PD000465

215

267

S=138 I=58 E=3.34607e-09

PD066084

265

307

S=131 I=64 E=2.25829e-08

PD956729

149

194

S=127 I=54 E=7.45642e-08

PDA424V1

17

84

S=117 I=37 E=1.24615e-06

PDA1F3Z5

65

146

S=116 I=26 E=1.33618e-06

PD683767

32

79

S=116 I=42 E=1.37159e-06

Iprscan IPR015424 [SSF53383]

1

427

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RRtMzOYt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

291 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiVFw14/XFF4834R_chr12270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiVFw14/XFF4834R_chr12270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiVFw14/XFF4834R_chr12270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiVFw14/XFF4834R_chr12270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.