Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11840raxCXFF4834R_chr11840outer membrane efflux protein RaxC

raxC XFF4834R_chr11840
XFF4834R_chr11830
XFF4834R_chr11830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11850
XFF4834R_chr11850
ID raxC
AC XFF4834R_chr11840
LT XFF4834R_chr11840
OR XFF4834R_chr from 1327990 to 1329372 on strand -
DE outer membrane efflux protein RaxC
IP Outer membrane efflux protein
CL 4.1.B.17 The Outer Membrane Factor (OMF) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: protein transport (GO:0015031)
Cellular Component: outer membrane (GO:0019867)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN
CC COG: [MU] Cell wall/membrane/envelope biogenesis;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100824)
MW 49621.9 Da
SQ 460 aa
 
........10........20........30........40........50
| | | | |
MIRRSLVLALAAALSPMAAHATDLLQVYEMARNGDPQLAVAESTRLVNRE
GQVQARAALLPQLDGSAGYTQSHRELEGVDGRSTTKQRQYAIQGSQTIFN
WAQFSNLRAQREVAKAADFTLASANNDLITRTSAAYFQVLVGIESLAAAE
TNEAAAKKQFDYADKRLEVGLAPITDVHEARAQYDQARADTITARNTLKD
YYQALTELTGQPVVGLRALPDEFRPEVPAAYSNVDQLVATAIADNPALKA
QQLQVSAAEAQVSAARAGHLPTLSLGANVGRSNSWGGQGTVDEAAGNFTT
AGRNIDTDSVGITLTIPIFAGGATQSAVRQALSQRDIQQDTYEQQKRALD
RNTRNAYQTVVAGISEVEARRLAVVSAQAAYDASQVGLEVGTRTVLDVVQ
NQRTLFQAQLNYAQSRYNFLQNRLLLGQAIGKLDITDLQDVNRMLSQDAE
SKLQGSGSLQ
X.species

NP_643770.1 lcl|tolC-XAC3463

1

460

S=2117 I=90 E=0

TolC protein

X.species

YP_365322.1 lcl|raxC-XCV3591

1

460

S=2103 I=90 E=0

outer membrane efflux protein RaxC

X.species

NP_638682.1 lcl|tolC-XCC3336

1

460

S=1826 I=78 E=0

TolC protein

X.species

lcl|tolC-XALc_0747

1

460

S=1365 I=60 E=3.59552e-158

probable outer membrane efflux protein.

pubmed

1

460

S=1967 I=84 E=0

Outer membrane protein RaxC TolC protein

Pubmed 15195942

 

prodomImg

pubmed

23

447

S=517 I=34 E=8.30109e-54

Outer membrane protein tolC ; Cell Repeat Signal Transmembrane Transport

Pubmed 6312426,2216730

 

prodomImg

pubmed

24

442

S=501 I=32 E=7.59529e-52

Outer membrane protein TolC

Pubmed 17350794

 

prodomImg

pubmed

23

442

S=500 I=32 E=1.14422e-51

Outer membrane protein TolC

Pubmed 17350794

 

prodomImg

pubmed

23

447

S=485 I=32 E=6.36926e-50

Outer membrane protein tolC ; Cell Signal Transport Virulence

Pubmed 8801424

 

prodomImg

sp

23

447

S=517 I=34 E=5.6444e-54

Outer membrane protein tolC ; Cell Repeat Signal Transmembrane Transport

 

prodomImg

sp

23

447

S=485 I=32 E=4.33084e-50

Outer membrane protein tolC ; Cell Signal Transport Virulence

 

prodomImg

sp

23

442

S=447 I=31 E=1.69669e-45

Outer membrane protein tolC ; Cell Signal Transport

 

prodomImg

sp

24

441

S=300 I=27 E=1.25349e-27

Alkaline protease secretion protein AprF ; Cell membrane outer Transport

 

prodomImg

sp

24

438

S=234 I=24 E=1.22362e-19

Proteases secretion protein prtF ; Cell membrane outer Signal Transport

 

prodomImg

Iprscan IPR003423 [PF02321]

24

210

Outer membrane efflux protein

Iprscan IPR003423 [PF02321]

235

431

Outer membrane efflux protein

Iprscan IPR010130 [TIGR01844]

20

447

Type I secretion outer membrane protein, TolC

Iprscan [seg]

6

21

-

Iprscan [seg]

147

156

-

Iprscan [seg]

250

267

-

Iprscan [SignalP-NN(euk)]

1

21

-

PD838625

121

445

S=406 I=35 E=1.34984e-41

PDA1S3J4

429

460

S=153 I=97 E=5.35832e-11

PD710063

355

416

S=102 I=40 E=7.96217e-05

Iprscan [SSF56954]

22

454

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WsRAKKT4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTKQje6/XFF4834R_chr11840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTKQje6/XFF4834R_chr11840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTKQje6/XFF4834R_chr11840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTKQje6/XFF4834R_chr11840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.