Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11250XFF4834R_chr11710153_1257112_f2_XFF4834R-XFF4834R_chr11250XFF4834R_chr11250DNA polymerase III subunit delta'

XFF4834R_chr11710153_1257112_f2_XFF4834R-XFF4834R_chr11250 XFF4834R_chr11250
XFF4834R_chr11240
XFF4834R_chr11240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11260
XFF4834R_chr11260
ID XFF4834R_chr11710153_1257112_f2_XFF4834R-XFF4834R_chr11250
AC XFF4834R_chr11250
LT XFF4834R_chr11250
OR XFF4834R_chr from 1256153 to 1257112 on strand +
DE DNA polymerase III subunit delta'
IP
CL 2.1.1 DNA replication GO:0006261
EC
GO InterPro


Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101103)
MW 34772.1 Da
SQ 319 aa
 
........10........20........30........40........50
| | | | |
MTAAFSPWQQRAFDQTVAALDAGRLGHGLLICGPEGLGKRAVALALAEHV
LASSPDPALAQRTRQLIAAGTHPDLQLVSFIPNRTGDKLRTEIVIEQVRE
ISQKLALTPQYGIAQVVIVDPADAINRSACNALLKTLEEPSPGRYLWLIS
AQPARLPATIRSRCQRLEFKLPPAHEALAWLLSQGVSERAAQESLDAARG
HPGLAAQWLREDGLAVRRAVAQDLEQIANGRAGAVDVAQRWTNDGQADQR
LRHAADLALAQASAGLTDPSRLHKLATWFDAANRTRDLLRTTVRADLALT
ELLLSWREGERQPRSRGTR
XFF4834R

XFF4834R_chr11030 lcl|XFF4834R_chr11490347_1235416_f2_XFF4834R-XFF4834R_chr11030

19

170

S=164 I=32 E=2.04126e-13

X.species

NP_641469.1 lcl|holB-XAC1132

1

319

S=1450 I=89 E=1.39947e-168

DNA polymerase III subunit delta'

X.species

YP_362882.1 lcl|holB-XCV1151

1

319

S=1444 I=89 E=7.39921e-168

DNA polymerase III subunit delta'

X.species

NP_636399.1 lcl|holB-XCC1023

1

319

S=1388 I=85 E=4.03067e-161

DNA polymerase III subunit delta'

X.species

lcl|holB-XALc_0632

5

319

S=1171 I=73 E=8.56933e-135

probable dna polymerase III, delta prime subunit protein

X.species

NP_636377.1 lcl|dnaX-XCC1001

19

170

S=168 I=32 E=2.36448e-13

DNA polymerase III subunits gamma and tau

X.species

lcl|dnaX-XALc_0612

19

170

S=168 I=32 E=2.86443e-13

probable dna polymerase III tau and gamma subunits protein

X.species

YP_362858.1 lcl|dnaX-XCV1127

19

170

S=166 I=32 E=4.74959e-13

DNA polymerase III subunits gamma and tau

X.species

NP_641446.1 lcl|dnaX-XAC1109

19

170

S=165 I=32 E=6.27804e-13

DNA polymerase III subunits gamma and tau

pubmed

5

169

S=716 I=82 E=4.14033e-78

DNA polymerase holoenzyme subunit

Pubmed 11094291

 

prodomImg

pubmed

2

243

S=249 I=35 E=1.77013e-21

DNA polymerase III subunit delta' EC=2.7.7.7 ; replication DNA-directed Nucleotidyltransferase

Pubmed 8550441

 

prodomImg

pubmed

5

224

S=196 I=33 E=4.1391e-15

DNA polymerase III subunit delta' EC=2.7.7.7 ; replication DNA-directed Nucleotidyltransferase

Pubmed 8505303,8509334

 

prodomImg

pubmed

9

170

S=196 I=31 E=4.55572e-15

DNA polymerase III holoenzyme tau subunit ; ATP-binding Nucleotide-binding

Pubmed 9299346

 

prodomImg

pubmed

5

233

S=173 I=29 E=2.60095e-12

DNA polymerase III subunit delta' EC=2.7.7.7 ; replication DNA-directed Nucleotidyltransferase

Pubmed 7584024

 

prodomImg

pubmed

95

186

S=159 I=38 E=1.37402e-10

DNA polymerase III gamma and tau subunits ; ATP-binding Chloroplast Nucleotide-binding Plastid

Pubmed 17522086

 

prodomImg

pubmed

95

170

S=158 I=39 E=1.62157e-10

DNA polymerase III subunit gamma/tau EC=2.7.7.7 ; ATP-binding replication DNA-directed Nucleotide-binding Nucleotidyltransferase

Pubmed 2124672,7584024

 

prodomImg

pubmed

95

166

S=150 I=40 E=1.5511e-09

DNA polymerase III subunit gamma/tau EC=2.7.7.7 ; Nucleotidyltransferase

Pubmed 12446909

 

prodomImg

pubmed

10

170

S=150 I=28 E=1.56469e-09

DNA polymerase III tau homolog DnaX ; ATP-binding Nucleotide-binding

Pubmed 9190815,7544413

 

prodomImg

pubmed

93

205

S=149 I=39 E=2.14162e-09

Putative uncharacterized protein

Pubmed 8673341

 

prodomImg

sp

2

243

S=249 I=35 E=1.21862e-21

DNA polymerase III subunit delta' EC=2.7.7.7 ; replication DNA-directed Nucleotidyltransferase

 

prodomImg

sp

1

218

S=220 I=32 E=4.01358e-18

DNA polymerase III subunit delta' EC=2.7.7.7 ; replication DNA-directed Nucleotidyltransferase

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

3

172

-

Iprscan [seg]

41

52

-

Iprscan [seg]

247

264

-

PDA1F5G4

1

95

S=384 I=77 E=5.33456e-39

PD389911

208

307

S=381 I=78 E=1.18975e-38

PDA1F724

96

149

S=123 I=50 E=2.21012e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zXzyrOPp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfQtOgT/XFF4834R_chr11250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfQtOgT/XFF4834R_chr11250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfQtOgT/XFF4834R_chr11250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfQtOgT/XFF4834R_chr11250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.