Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11240XFF4834R_chr_1255089_1256156_f3_XFF4834R-XFF4834R_chr11240XFF4834R_chr11240hypothetical protein

XFF4834R_chr_1255089_1256156_f3_XFF4834R-XFF4834R_chr11240 XFF4834R_chr11240
XFF4834R_chr11230
XFF4834R_chr11230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11250
XFF4834R_chr11250
ID XFF4834R_chr_1255089_1256156_f3_XFF4834R-XFF4834R_chr11240
AC XFF4834R_chr11240
LT XFF4834R_chr11240
OR XFF4834R_chr from 1255089 to 1256156 on strand +
DE hypothetical protein
IP Aminodeoxychorismate lyase
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100506)
MW 38315.8 Da
SQ 355 aa
 
........10........20........30........40........50
| | | | |
MAVTGKRGCLAVLGTGVLLAALLAIAAVVAWRHYLHFADTPVPASAPSVV
IAPGDSLKATLRKLRAAGLAQGTELEWQLLARQVDAAGKLKVGEYALSPA
LSPRELLTRMRQGRVIQYRFTIVEGWNFRQLRAALATATPLQHSIDALDD
AALMARLGVAKQHPEGRFLPETYVYQRGDSDIDVLKRAHAAMDKALAQAW
EQRAPNLPLASPEQALILASIIEKETALASERPLIAGVFLRRLQLGMKLQ
TDPTVIYGIGGSYDGNIRRRDLTTDTPYNTYTRTGLTPTPIAMPGREALL
AAVRPAPGEALYFVAVGDGTGAHAFSATLAEHNAAVARYLQRRRLPSTPQ
TEPTP
X.species

NP_641468.1 lcl|XAC1131-XAC1131

1

355

S=1548 I=86 E=1.90228e-180

hypothetical protein

X.species

YP_362881.1 lcl|XCV1150

3

355

S=1523 I=85 E=2.05242e-177

hypothetical protein

X.species

NP_636398.1 lcl|XCC1022

1

355

S=1368 I=76 E=1.20773e-158

hypothetical protein

X.species

lcl|XALc_0630

31

344

S=1066 I=66 E=4.89668e-122

hypothetical protein

pubmed

31

344

S=1057 I=66 E=2.23118e-119

ORF340

Pubmed 11094291

 

prodomImg

pubmed

184

341

S=407 I=52 E=1.44827e-40

Putative uncharacterized protein yceG

Pubmed 10491164

 

prodomImg

pubmed

48

339

S=394 I=37 E=5.35136e-39

Putative uncharacterized protein

Pubmed 10639170,17184993

 

prodomImg

pubmed

211

336

S=184 I=38 E=1.51828e-13

Putative uncharacterized protein

Pubmed 12837387

 

prodomImg

pubmed

158

347

S=180 I=29 E=4.63472e-13

NovB

Pubmed 10770754

 

prodomImg

pubmed

117

343

S=163 I=30 E=5.41321e-11

Putative uncharacterized protein

Pubmed 15870461

 

prodomImg

pubmed

213

315

S=131 I=32 E=3.36925e-07

Aminodeoxychorismate lyase-like protein

Pubmed 11410354

 

prodomImg

sp

88

344

S=513 I=40 E=1.27521e-53

Uncharacterized protein HI0457

 

prodomImg

sp

36

341

S=485 I=37 E=2.81234e-50

Uncharacterized protein yceG

 

prodomImg

Iprscan IPR003770 [PF02618]

47

339

Uncharacterised protein family YceG-like

Iprscan IPR003770 [TIGR00247]

1

350

Uncharacterised protein family YceG-like

Iprscan [seg]

10

30

-

Iprscan [seg]

146

157

-

Iprscan [seg]

273

284

-

Iprscan [tmhmm]

9

31

-

PD686410

114

272

S=357 I=44 E=7.78649e-36

PD284880

31

116

S=352 I=80 E=4.04567e-35

PD009996

285

344

S=178 I=60 E=4.18884e-14

PDA5O6N6

40

164

S=133 I=31 E=1.3301e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JgZIjlu0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIfUvMI/XFF4834R_chr11240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIfUvMI/XFF4834R_chr11240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIfUvMI/XFF4834R_chr11240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIfUvMI/XFF4834R_chr11240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.