Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11230XFF4834R_chr11690667_1255022_f3_XFF4834R-XFF4834R_chr11230XFF4834R_chr11230probable ADC synthase

XFF4834R_chr11690667_1255022_f3_XFF4834R-XFF4834R_chr11230 XFF4834R_chr11230
XFF4834R_chr11220
XFF4834R_chr11220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11240
XFF4834R_chr11240
ID XFF4834R_chr11690667_1255022_f3_XFF4834R-XFF4834R_chr11230
AC XFF4834R_chr11230
LT XFF4834R_chr11230
OR XFF4834R_chr from 1253667 to 1255022 on strand +
DE probable ADC synthase
IP Para-aminobenzoate synthase/anthranilate synthase, component I; Chorismate binding, C-terminal; Anthranilate synthase component I, C-terminal
CL 1.5.1 Amino acids GO:0008652
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: oxo-acid-lyase activity (GO:0016833)

Curated
PM
AN difficult to say if it is a Para-aminobenzoate synthase or a anthranilate synthase (pab or trp)
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110304)
MW 48420.5 Da
SQ 451 aa
 
........10........20........30........40........50
| | | | |
MTLTRSLHADIDLLALHRLSPQRYPALLESSASGTEHGRWDVLLLADGPC
LRLDPDGCTRDGAGQVLEGGFLAALDAAWQAERVPHDAASPWPFRGGWAV
LLDYELAAQVEPILQLPMRRDGVPTALALRAPAAVLRDRLHGRCVALAEP
GREELLQQIGDDLAACAALPPLPAWAGPLAVDEEAPERFTAAVERVLDYL
RAGDVFQANISRAWQAAFAAAVDPAALHARLRAANPAPFAGLFVAAGRAV
ASSSPERLVSVQGDVVQTRPIAGTRARFAGDDDAARIRELVGHPKERAEH
VMLIDLERNDLGRICAPGTVEVDELMCVESYAHVHHIVSNVRGRLRAGVT
PGEVIAAVFPGGTITGCPKVRCMQVIAELEQTARGAYTGAFGWLNRDGDM
DLNILIRTAEVAGHQVHFRTGAGIVVDSDPQRELDETRAKARGVLRAIEQ
T
XFF4834R

XFF4834R_chr04650 lcl|XFF4834R_chr04820041_0534516_f1_XFF4834R-XFF4834R_chr04650

185

450

S=503 I=41 E=2.67817e-54

XFF4834R

XFF4834R_chr04650 lcl|XFF4834R_chr04820041_0534516_f1_XFF4834R-XFF4834R_chr04650

185

450

S=503 I=41 E=2.67817e-54

pubmed

1

449

S=1349 I=63 E=1.15884e-154

Aminodeoxychorismate synthase subunit I

Pubmed 11094291

 

prodomImg

pubmed

189

449

S=575 I=44 E=8.31997e-61

Para-aminobenzoate synthase component 1 EC=2.6.1.85 ; Folate biosynthesis Transferase

Pubmed 2123867,7584024

 

prodomImg

pubmed

3

447

S=517 I=34 E=7.64723e-54

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

3

447

S=513 I=33 E=2.21543e-53

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

187

450

S=503 I=43 E=3.83394e-52

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 2844259

 

prodomImg

pubmed

189

448

S=495 I=41 E=3.63549e-51

Para-aminobenzoate synthase component I/anthranilate synthase component I

Pubmed 18043661

 

prodomImg

pubmed

187

448

S=493 I=41 E=5.87247e-51

Probable anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 3141423

 

prodomImg

pubmed

185

450

S=482 I=39 E=1.40317e-49

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 2732211

 

prodomImg

pubmed

3

447

S=478 I=33 E=3.96007e-49

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

3

447

S=478 I=33 E=3.96007e-49

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

sp_Pdown

sp|P74130|TRE2_SYNY3

93

449

S=603 I=38 E=1.89717e-64

Anthranilate synthase component I-like protein EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

sp_Pdown

sp|P28820|PABB_BACSU

189

449

S=575 I=44 E=5.7267e-61

Para-aminobenzoate synthase component 1 EC=2.6.1.85 ; Folate biosynthesis Transferase

sp_Pdown

sp|Q9XAZ0|TRPE_NEIMA

3

447

S=517 I=34 E=5.26365e-54

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

sp_Pdown

sp|Q9S358|TRPE_NEIMF

3

447

S=513 I=33 E=1.5249e-53

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

sp_Pdown

sp|Q5V448|TRPE1_HALMA

187

450

S=512 I=43 E=2.21851e-53

Anthranilate synthase component 1 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Iprscan IPR019999 [PR00095]

288

301

Anthranilate synthase component I, C-terminal

Iprscan IPR019999 [PR00095]

302

315

Anthranilate synthase component I, C-terminal

Iprscan IPR019999 [PR00095]

382

396

Anthranilate synthase component I, C-terminal

Iprscan IPR019999 [PR00095]

397

411

Anthranilate synthase component I, C-terminal

Iprscan IPR005801 [G3DSA:3.60.120.10]

1

448

ADC synthase

Iprscan [PTHR11236:SF9]

59

449

-

Iprscan IPR005801 [PTHR11236]

59

449

ADC synthase

Iprscan IPR015890 [PF00425]

187

440

Chorismate binding, C-terminal

Iprscan IPR006805 [PF04715]

14

144

Anthranilate synthase component I, N-terminal

Iprscan IPR010118 [TIGR01824]

96

444

Para-aminobenzoate synthase/anthranilate synthase, component I

Iprscan [seg]

126

140

-

Iprscan [seg]

163

180

-

Iprscan [seg]

210

229

-

Iprscan [seg]

272

286

-

PD308394

4

205

S=572 I=59 E=8.81693e-62

PD000779

185

448

S=512 I=41 E=1.46616e-54

PD557135

288

448

S=118 I=24 E=8.34802e-07

PDA2O653

187

256

S=106 I=35 E=2.50219e-05

Iprscan IPR005801 [SSF56322]

1

449

ADC synthase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nacYN3QW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

172 hits
swiss-prot

Swiss-Prot ncbi-blastp

95 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7LExsy/XFF4834R_chr11230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7LExsy/XFF4834R_chr11230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7LExsy/XFF4834R_chr11230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7LExsy/XFF4834R_chr11230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.