Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11220fabFXFF4834R_chr112203-oxoacyl-[acyl-carrier-protein] synthase II

fabF XFF4834R_chr11220
XFF4834R_chr11210
XFF4834R_chr11210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11230
XFF4834R_chr11230
ID fabF
AC XFF4834R_chr11220
LT XFF4834R_chr11220
OR XFF4834R_chr from 1252266 to 1253501 on strand +
DE 3-oxoacyl-[acyl-carrier-protein] synthase II
IP Beta-ketoacyl synthase; Thiolase-like
CL 1.5.4 Fatty acid and phosphatidic acid GO:0006633 GO:0006654
EC
GO InterPro
Biological Process: fatty acid biosynthetic process (GO:0006633)
Biological Process: biosynthetic process (GO:0009058)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN FEMS Microbiol Lett. 2000 Dec 1;193(1):129-36. Characterization of the acyl carrier protein gene and the fab gene locus in Xanthomonas albilineans.
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100824)
MW 42839.3 Da
SQ 411 aa
 
........10........20........30........40........50
| | | | |
MSRRVVVTGMGMVSPLGNDLATSWDGIVHGRSGIGPITQIDASQFTTKIA
GEIKNFDPTLFVSAKDVKKMDSFIHYGVGASFMALDDSGLEIDESNAERV
GAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIK
GLKGPTFSAVSACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVG
GFCAMKAMSTRNDDPAGASRPWDKQRDGFVLGDGAGVLVLEEYEHAKARG
ARIYAELVGFGASSDAYHMTAPSEDGEGAARSMAAAMRDAKLNPEQIGYL
NAHGTSTPLGDLAETMAMKRALGGHAYKTMVSSTKSMTGHLLGAAGGVEA
IFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGFG
GTNGTLVFKRV
XFF4834R

XFF4834R_chr35210 lcl|fabB-XFF4834R_chr35210

3

410

S=577 I=37 E=3.10304e-63

3-oxoacyl-[acyl-carrier-protein] synthase I

XFF4834R

XFF4834R_chr39540 lcl|XFF4834R_chr42810403_4557602_f3_XFF4834R-XFF4834R_chr39540

151

375

S=297 I=35 E=2.09133e-29

X.species

NP_641466.1 lcl|fabF-XAC1129

1

411

S=1929 I=90 E=0

3-oxoacyl-(acyl carrier protein) synthase II

X.species

YP_362879.1 lcl|fabF-XCV1148

1

411

S=1927 I=90 E=0

3-oxoacyl-(acyl carrier protein) synthase II

X.species

NP_636396.1 lcl|fabF-XCC1020

1

411

S=1897 I=88 E=0

3-oxoacyl-(acyl carrier protein) synthase II

X.species

lcl|fabF-XALc_0628

1

411

S=1702 I=77 E=0

probable 3-oxoacyl-(acyl-carrier protein) synthase II

X.species

lcl|XALc_1783

2

394

S=634 I=39 E=1.44802e-69

hypothetical_protein

X.species

YP_365473.1 lcl|fabB-XCV3742

3

411

S=591 I=38 E=1.95655e-64

3-oxoacyl-[acyl-carrier protein] synthase II

X.species

NP_635973.1 lcl|fabB-XCC0581

3

411

S=587 I=39 E=5.5702e-64

beta-ketoacyl-[ACP] synthase I

X.species

NP_643932.1 lcl|fabB-XAC3625

3

410

S=573 I=37 E=2.99436e-62

beta-ketoacyl-[ACP] synthase I

X.species

lcl|fabF-XALc_0142

146

375

S=301 I=35 E=2.86261e-29

probable 3-oxoacyl-[acyl-carrier protein] synthase II precursor

X.species

NP_644385.1 lcl|fabF-XAC4086

151

375

S=297 I=35 E=9.53454e-29

3-oxoacyl-(acyl carrier protein) synthase I

X.species

YP_365903.1 lcl|fabF-XCV4172

151

375

S=290 I=34 E=5.74539e-28

3-oxoacyl-(acyl carrier protein) synthase I

X.species

NP_639337.1 lcl|fabF-XCC3998

151

375

S=279 I=33 E=1.38482e-26

3-oxoacyl-(acyl carrier protein) synthase I

X.species

lcl|albI-XALc_1529

142

367

S=228 I=29 E=2.24524e-20

polyketide non-ribosomal peptide synthase;albicidin synthetase protein

X.species

lcl|albI-XALc_1529

139

360

S=178 I=26 E=2.21462e-14

polyketide non-ribosomal peptide synthase;albicidin synthetase protein

pubmed

1

411

S=1702 I=77 E=0

Ketoacyl synthase II ; Transferase

Pubmed 11094291

 

prodomImg

pubmed

3

410

S=1201 I=55 E=1.12847e-136

3-oxoacyl-(Acyl-carrier-protein) synthase II EC=2.3.1.41 ; Acyltransferase

Pubmed 16645985

 

prodomImg

pubmed

3

411

S=1177 I=55 E=7.73718e-134

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

Pubmed 8550484

 

prodomImg

pubmed

3

411

S=1167 I=55 E=1.23792e-132

Beta-ketoacyl-acyl carrier protein synthase II ; Transferase

Pubmed 10671446

 

prodomImg

pubmed

3

411

S=1136 I=53 E=7.57175e-129

3-oxoacyl-acyl-carrier-protein synthase II ; Transferase

Pubmed 20088879

 

prodomImg

sp

3

411

S=1177 I=55 E=5.26552e-134

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

 

prodomImg

sp

3

411

S=1157 I=55 E=1.63291e-131

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

 

prodomImg

sp

3

411

S=1136 I=53 E=5.15294e-129

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

 

prodomImg

sp

3

411

S=1136 I=53 E=5.15294e-129

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

 

prodomImg

sp

3

411

S=1136 I=53 E=5.15294e-129

3-oxoacyl-[acyl-carrier-protein] synthase 2 EC=2.3.1.179 ; Acyltransferase Fatty acid biosynthesis Lipid

 

prodomImg

Iprscan IPR016038 [G3DSA:3.40.47.10]

7

259

Thiolase-like, subgroup

Iprscan IPR016038 [G3DSA:3.40.47.10]

262

410

Thiolase-like, subgroup

Iprscan [PTHR11712:SF23]

1

410

-

Iprscan IPR000794 [PTHR11712]

1

410

Beta-ketoacyl synthase

Iprscan IPR014030 [PF00109]

3

246

Beta-ketoacyl synthase, N-terminal

Iprscan IPR014031 [PF02801]

254

369

Beta-ketoacyl synthase, C-terminal

Iprscan IPR020841 [SM00825]

5

411

Polyketide synthase, beta-ketoacyl synthase region

Iprscan IPR017568 [TIGR03150]

3

409

3-oxoacyl-[acyl-carrier-protein] synthase 2

Iprscan IPR018201 [PS00606]

154

170

Beta-ketoacyl synthase, active site

Iprscan [seg]

101

114

-

Iprscan [seg]

279

290

-

Iprscan [seg]

395

405

-

PDA1F6K2

306

360

S=178 I=65 E=4.36042e-14

PD000224

201

278

S=165 I=51 E=1.54244e-12

PDA018Y7

5

257

S=157 I=25 E=1.54116e-11

PD946878

1

55

S=149 I=51 E=1.4487e-10

PD574073

18

380

S=130 I=22 E=2.52691e-08

PDA3F933

221

372

S=130 I=29 E=3.00829e-08

PDA004B7

168

260

S=128 I=40 E=5.16515e-08

PDA1F6P1

362

394

S=124 I=65 E=1.61851e-07

PDA1E0C3

30

65

S=119 I=58 E=5.8819e-07

PD950063

2

69

S=106 I=35 E=2.39212e-05

Iprscan IPR016039 [SSF53901]

213

411

Thiolase-like

Iprscan IPR016039 [SSF53901]

2

251

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RUmJcW7o)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZuBoLU/XFF4834R_chr11220.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZuBoLU/XFF4834R_chr11220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZuBoLU/XFF4834R_chr11220.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZuBoLU/XFF4834R_chr11220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.