Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11210acpPXFF4834R_chr11210acyl carrier protein (ACP)

acpP XFF4834R_chr11210
XFF4834R_chr11200
XFF4834R_chr11200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11220
XFF4834R_chr11220
ID acpP
AC XFF4834R_chr11210
LT XFF4834R_chr11210
OR XFF4834R_chr from 1251885 to 1252124 on strand +
DE acyl carrier protein (ACP)
IP Acyl carrier protein-like
CL 1.6.15.4 Acyl carrier protein GO:0042967
EC
GO InterPro
Biological Process: fatty acid biosynthetic process (GO:0006633)
Molecular Function: acyl carrier activity (GO:0000036)
Molecular Function: cofactor binding (GO:0048037)
Molecular Function: phosphopantetheine binding (GO:0031177)

Curated
PM
AN FEMS Microbiol Lett. 2000 Dec 1;193(1):129-36. Characterization of the acyl carrier protein gene and the fab gene locus in Xanthomonas albilineans.
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100824)
MW 8802.8 Da
SQ 79 aa
 
........10........20........30........40........50
| | | | |
MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEE
FECEIPDEEAEKITSVQQAIDYVKAHVKS
Show or not Domain decomposition
 
X.species

YP_362878.1 lcl|acpP-XCV1147

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

X.species

NP_636395.1 lcl|acpP-XCC1019

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

X.species

NP_641465.1 lcl|acpP-XAC1128

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

X.species

lcl|acpP-XALc_0627

1

79

S=291 I=80 E=2.81831e-29

probable acyl carrier protein (acp).

pubmed

1

79

S=291 I=80 E=1.49295e-27

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 11094291

 

prodomImg

pubmed

1

76

S=260 I=72 E=1.08713e-23

Acyl carrier protein 1 ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 10464226

 

prodomImg

pubmed

1

76

S=253 I=70 E=7.46618e-23

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 9171419

 

prodomImg

pubmed

1

76

S=246 I=67 E=4.23266e-22

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 1556094,8359454

 

prodomImg

pubmed

1

76

S=244 I=68 E=7.99886e-22

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 9171419

 

prodomImg

sp

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

 

prodomImg

sp

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

 

prodomImg

sp

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

 

prodomImg

sp

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

 

prodomImg

sp

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

 

prodomImg

Iprscan [G3DSA:1.10.1200.10]

4

73

-

Iprscan IPR003231 [MF_01217]

3

77

Acyl carrier protein (ACP)

Iprscan [PTHR20863:SF5]

1

77

-

Iprscan [PTHR20863]

1

77

-

Iprscan IPR006163 [PF00550]

6

73

Phosphopantetheine-binding

Iprscan IPR003231 [TIGR00517]

1

77

Acyl carrier protein (ACP)

Iprscan IPR006162 [PS00012]

32

47

Phosphopantetheine attachment site

Iprscan IPR009081 [PS50075]

4

74

Acyl carrier protein-like

Iprscan [seg]

48

61

-

PDA1D7S2

2

33

S=125 I=84 E=1.10518e-07

PD000887

34

77

S=110 I=52 E=7.01147e-06

PDA19706

3

39

S=109 I=59 E=9.59673e-06

PDA1O107

16

40

S=103 I=84 E=4.49091e-05

Iprscan IPR009081 [SSF47336]

1

73

Acyl carrier protein-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6IqMerlc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

57 hits
swiss-prot

Swiss-Prot ncbi-blastp

491 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByMEFJQ/XFF4834R_chr11210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByMEFJQ/XFF4834R_chr11210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByMEFJQ/XFF4834R_chr11210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByMEFJQ/XFF4834R_chr11210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.