Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10750opsXXFF4834R_chr10750Probable lipopolysaccharide core biosynthesis glycosyl transferase

opsX XFF4834R_chr10750
XFF4834R_chr10740
XFF4834R_chr10740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10760
XFF4834R_chr10760
ID opsX
AC XFF4834R_chr10750
LT XFF4834R_chr10750
OR XFF4834R_chr from 1213446 to 1214495 on strand -
DE Probable lipopolysaccharide core biosynthesis glycosyl transferase
IP Glycosyl transferase, family 9
CL 1.6.3 Lipopolysaccharide GO:0009103
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)

Curated
PM
AN lipopolysaccharide core biosynthesis heptosyltransferase, this gene is named opsX in Xanthomonads and rfaQ in Ecoli
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110224)
MW 38466.7 Da
SQ 349 aa
 
........10........20........30........40........50
| | | | |
MAVTPASLCLLRLSALGDVTHVVPLVRTLQAGLPETQLHWIIDRAGLKLL
DGLPGVQFHTYDKRSGAAGMRALRRSLAPLGRFDALLQMQVALRANVLSA
FVPARRRIGYDRSRSKDLHGLFVNERIADRPGIHVLDAIGSFAEPLGLRQ
TQVRWDLPVPDEAHAWARAQWDDDGRPVLMISPCSSHARRNWYPDRHAAL
ADHAAAQGWRIVLCGGRSDLERSTADAIVAAARTPVLDLVGKDTLKQLPA
LLARATLVVTPDSGPMHIANAMGTKVLGLHAASNPRRSGPYSDVRYCVDR
YDAAARKFLQKPADQLSWGTKIEFDEVMSLITVDDAIAAFERYRADHRR
X.species

NP_641432.1 lcl|opsX-XAC1094

1

349

S=1730 I=96 E=0

saccharide biosynthesis regulatory protein

X.species

NP_636369.1 lcl|opsX-XCC0992

1

347

S=1530 I=87 E=2.97147e-178

saccharide biosynthesis regulatory protein

X.species

lcl|XALc_0603

7

347

S=1375 I=81 E=1.9584e-159

putative lipopolysaccharide core biosynthesis heptosyltransferase protein

X.species

YP_362833.1 lcl|opsX-XCV1102

70

349

S=1355 I=94 E=4.71642e-157

lipopolysaccharide core biosynthesis heptosyltransferase

pubmed

70

349

S=1261 I=88 E=4.56854e-144

DNA, complete cds

Pubmed 8376331

 

prodomImg

pubmed

5

346

S=625 I=39 E=4.6743e-67

WaaC

Pubmed 18310345

 

prodomImg

pubmed

5

346

S=618 I=38 E=3.9574e-66

WaaC

Pubmed 19151135

 

prodomImg

pubmed

102

342

S=420 I=34 E=3.61755e-42

Lipopolysaccharide biosynthesis protein

Pubmed 17185550

 

prodomImg

pubmed

102

250

S=228 I=33 E=6.30931e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

sp

5

342

S=624 I=36 E=4.59015e-67

Putative glycosyltransferase HI_0261 EC=2.-.-.-

 

prodomImg

sp

17

293

S=173 I=22 E=2.38136e-12

Lipopolysaccharide core heptosyltransferase rfaQ EC=2.-.-.- ; Glycosyltransferase biosynthesis

 

prodomImg

sp

17

293

S=147 I=21 E=3.45586e-09

Lipopolysaccharide core heptosyltransferase rfaQ EC=2.-.-.- ; Glycosyltransferase biosynthesis

 

prodomImg

sp

176

293

S=121 I=28 E=4.32432e-06

ADP-heptose--LPS heptosyltransferase 2 EC=2.-.-.- ; Glycosyltransferase Lipopolysaccharide biosynthesis

 

prodomImg

Iprscan [G3DSA:3.40.50.2000]

7

111

-

Iprscan [G3DSA:3.40.50.2000]

159

341

-

Iprscan IPR002201 [PF01075]

70

308

Glycosyl transferase, family 9

Iprscan [seg]

197

206

-

Iprscan [SignalP-NN(euk)]

1

17

-

PDA1G5M1

70

187

S=337 I=55 E=2.01878e-33

PD686447

299

347

S=221 I=86 E=2.8034e-19

PD002299

236

316

S=182 I=46 E=1.37773e-14

Iprscan [SSF53756]

7

342

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dMJcANmb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXTyoiM/XFF4834R_chr10750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXTyoiM/XFF4834R_chr10750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXTyoiM/XFF4834R_chr10750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXTyoiM/XFF4834R_chr10750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.