Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10470XFF4834R_chr11100237_1191943_r3_XFF4834R-XFF4834R_chr10470XFF4834R_chr10470putative Zn-dependent protease

XFF4834R_chr11100237_1191943_r3_XFF4834R-XFF4834R_chr10470 XFF4834R_chr10470
XFF4834R_chr10460
XFF4834R_chr10460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10480
XFF4834R_chr10480
ID XFF4834R_chr11100237_1191943_r3_XFF4834R-XFF4834R_chr10470
AC XFF4834R_chr10470
LT XFF4834R_chr10470
OR XFF4834R_chr from 1190237 to 1191943 on strand -
DE putative Zn-dependent protease
IP Peptidase M48, Ste24p
CL 1.2.3 Proteins/peptides/glycopeptides GO:0006508 GO:0009050
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: metalloendopeptidase activity (GO:0004222)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120330)
MW 61948.4 Da
SQ 568 aa
 
........10........20........30........40........50
| | | | |
MIHASAPGCPHAPRTTWEFHLRLLPLATALTLAVAIGVAPAQESRLPDIG
SSAGELLTPARQAEYGRMMLAELRNYDYVLDDPLITDWLQTMGTRLGANS
DQPQQPFTFFMLRDRQINAFATLGGYIAVNAGLVLTAEREDEVAAVLSHE
IAHVTQQHVLRGVERAQRDQIPILLGMLAAVVAAQQAGGNSKGDATMATI
TSAMGLMQQRQIDYTRSNESEADRLGIRTLARSGYDVDAMAGFFERMSVA
MRANEGGYSAPDFLQTHPVTVTRISEAKSRAEQMKKNTVVLTTSVPGGTR
QERVDPADPSLSEPLSRNGNALLPYALRLPVDALSRGADQQGFDWAKERL
RVLSAATPDAAIREYENLRRSAKQGLSDPQRYGLALARLRNSGGRPGEPV
AELSSLLEAHPDNLWLALGLSEAQARVGPREAANARFDALLKQLPNNRAV
ALTYATALNEQASKESGQRARQVLEPLLHRSSDDPLLQQSYARACELSGD
PLRASEAYAEAAFLNGRAEQALIQLEALKKKDLDYVTRARVDARIAAITP
TVLELRRQGIRDPDLSTR
XFF4834R

XFF4834R_chr00060 lcl|XFF4834R_chr00060494_0009300_f1_XFF4834R-XFF4834R_chr00060

111

285

S=169 I=29 E=9.50737e-14

XFF4834R

XFF4834R_chr00060 lcl|XFF4834R_chr00060494_0009300_f1_XFF4834R-XFF4834R_chr00060

111

285

S=169 I=29 E=9.50737e-14

X.species

YP_362804.1 lcl|XCV1073

1

568

S=2779 I=94 E=0

putative Zn-dependent protease

X.species

NP_641390.1 lcl|XAC1043-XAC1043

36

568

S=2695 I=97 E=0

hypothetical protein

X.species

NP_636350.1 lcl|XCC0964

36

568

S=2571 I=92 E=0

hypothetical protein

X.species

lcl|XALc_0576

38

565

S=1918 I=72 E=0

putative zn-dependent protease protein

X.species

lcl|XALc_0006

106

276

S=178 I=30 E=2.9546e-14

putative peptidase precursor protein

X.species

NP_640362.1 lcl|XAC0006-XAC0006

111

285

S=169 I=29 E=3.63925e-13

hypothetical protein

X.species

YP_361737.1 lcl|XCV0006

111

285

S=167 I=29 E=6.19425e-13

putative peptidase precursor

X.species

NP_635401.1 lcl|XCC0006

111

279

S=165 I=29 E=1.31108e-12

hypothetical protein

pubmed

39

289

S=384 I=36 E=1.25231e-37

Zinc-dependent protease ; Hydrolase Metal-binding Metalloprotease

Pubmed 18492059

 

prodomImg

pubmed

343

544

S=128 I=27 E=1.5175e-06

Zinc-dependent protease ; Hydrolase Metal-binding Metalloprotease

Pubmed 18492059

 

prodomImg

pubmed

111

279

S=165 I=29 E=5.16481e-11

Putative uncharacterized protein Putative uncharacterized protein orf268 ; Hydrolase Metal-binding Metalloprotease Zinc

Pubmed 12646254

 

prodomImg

pubmed

117

274

S=128 I=26 E=1.64138e-06

Metalloendopeptidase OMA1, mitochondrial EC=3.4.24.- ; Alternative splicing Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion Polym

Pubmed 12886954

 

prodomImg

sp

46

283

S=468 I=43 E=7.36243e-48

TPR repeat-containing protein VC_2164 ; Signal

 

prodomImg

sp

37

285

S=420 I=37 E=3.71106e-42

TPR repeat-containing protein YPO3069/y1412/YP_2691 ; Signal

 

prodomImg

sp

36

289

S=406 I=35 E=2.15779e-40

TPR repeat-containing protein yfgC ; Signal

 

prodomImg

sp

36

289

S=404 I=35 E=3.64082e-40

TPR repeat-containing protein yfgC ; Signal

 

prodomImg

sp

36

289

S=404 I=35 E=3.64082e-40

TPR repeat-containing protein yfgC ; Signal

 

prodomImg

PD906789

275

565

S=1239 I=82 E=1.32612e-142

PD002296

79

170

S=161 I=39 E=6.07453e-12

PD404561

211

283

S=153 I=43 E=5.46653e-11

PD899011

36

61

S=122 I=92 E=3.43223e-07

PDA4E6S7

1

20

S=118 I=95 E=1.00304e-06

PDA4E6S8

1

20

S=116 I=90 E=1.67772e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UaPflzpt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjwDVCm/XFF4834R_chr10470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjwDVCm/XFF4834R_chr10470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjwDVCm/XFF4834R_chr10470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjwDVCm/XFF4834R_chr10470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.