Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10400lpxHXFF4834R_chr10400UDP-2,3-diacylglucosamine hydrolase

lpxH XFF4834R_chr10400
XFF4834R_chr_1125
XFF4834R_chr_1125
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10410
XFF4834R_chr10410
ID lpxH
AC XFF4834R_chr10400
LT XFF4834R_chr10400
OR XFF4834R_chr from 1181037 to 1181780 on strand -
DE UDP-2,3-diacylglucosamine hydrolase
IP Metallophosphoesterase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: pyrophosphatase activity (GO:0016462)

Curated
PM
AN 41 codons deleted to fit with other Xanthomonadaceae. Not sure if this is really lpxH, as suggested by iANT automatic annotation. PRK05340: UDP-2,3-diacylglucosamine hydrolase. TIGR01854: This model represents LpxH, UDP-2,3-diacylglucosamine hydrolase, and essential enzyme in E. coli that catalyzes the fourth step in lipid A biosynthesis. Note that Pseudomonas aeruginosa has both a member of this family that shares this function and a more distant homolog, designated LpxH2, that does not. Many species that produce lipid A lack an lpxH gene in this family; some of those species have an lpxH2 gene instead, although for which the function is unknown. Original annotation: UDP-2,3-diacylglucosamine pyrophosphatase.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100722)
MW 26923.1 Da
SQ 247 aa
 
........10........20........30........40........50
| | | | |
MTTLFISDLHLDPARPAITELFLEFLRTQVPGSDALYILGDLFEAWIGDD
TPSTAADAVAVALHAVAGSGVPVFFMAGNRDFLVGETYAQRAGFRILPDP
TVIDLYGHTTLLMHGDLLCTDDTAYQAFRAQTRDPVFQAQFLAQPLAARV
AFAQQARAASQARHAELKQGDQSRFETVTDVSPAEVEATFVRYGLDRLIH
GHTHRPAIHTLQAGGNTCTRIVLGDWYEQGSVLRVDADGVSLEQLAL
Show or not Domain decomposition
 
X.species

YP_362797.1 lcl|XCV1066

1

247

S=1024 I=83 E=3.94339e-117

UDP-2,3-diacylglucosamine hydrolase

X.species

NP_641383.1 lcl|XAC1036-XAC1036

1

247

S=1014 I=82 E=6.42024e-116

UDP-2,3-diacylglucosamine hydrolase

X.species

NP_636343.1 lcl|XCC0957

1

247

S=967 I=75 E=2.69471e-110

UDP-2,3-diacylglucosamine hydrolase

X.species

lcl|lpxH-XALc_0569

1

245

S=784 I=62 E=4.16323e-88

probable udp-2,3-diacylglucosamine hydrolase protein

pubmed

1

242

S=499 I=42 E=6.00442e-52

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

Pubmed 12000770

 

prodomImg

sp

1

247

S=1014 I=82 E=1.7576e-114

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

 

prodomImg

sp

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

 

prodomImg

sp

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

 

prodomImg

sp

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

 

prodomImg

sp

1

247

S=967 I=75 E=7.37702e-109

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

 

prodomImg

Iprscan [G3DSA:3.60.21.10]

1

211

-

Iprscan [MF_00575]

1

247

-

Iprscan IPR004843 [PF00149]

1

206

Metallophosphoesterase

Iprscan IPR010138 [TIGR01854]

3

240

UDP-2,3-diacylglucosamine hydrolase

Iprscan [seg]

55

67

-

Iprscan [seg]

137

165

-

PDA061K5

168

243

S=237 I=57 E=2.72112e-21

PD038423

1

97

S=203 I=43 E=4.30508e-17

PDA1F9R1

98

135

S=150 I=74 E=9.06661e-11

Iprscan [SSF56300]

1

239

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lc75dm3l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

161 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoeEJn7/XFF4834R_chr10400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoeEJn7/XFF4834R_chr10400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoeEJn7/XFF4834R_chr10400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoeEJn7/XFF4834R_chr10400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.