Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10130gst2XFF4834R_chr10130probable glutathionine transferase

gst2 XFF4834R_chr10130
XFF4834R_chr10120
XFF4834R_chr10120
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1098
XFF4834R_chr_1098
ID gst2
AC XFF4834R_chr10130
LT XFF4834R_chr10130
OR XFF4834R_chr from 1147024 to 1147638 on strand -
DE probable glutathionine transferase
IP Intracellular chloride channel; Glutathione S-transferase, Mu class; Glutathione S-transferase, C-terminal-like; Thioredoxin-like fold
CL 5.6 Protection GO:0006950
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100521)
MW 22198.2 Da
SQ 204 aa
 
........10........20........30........40........50
| | | | |
MKLYTKPGACSLADHIVLRWSGLPFDLRVVDAATMKSPEYLRLNPAGAVP
LLLVDDWALTQNAAILNYIADIAPLTGLSGDGTARTRAEINRWIAFVNAD
VHPTFKPIFGSTAYLQDPALIARSQDDARVKLRTLYARVDAHLQGRTWLA
SDSHTGADAYLFVTLLWAQKVAVNLDGLNALQAFVQRMLADADVQAALKA
EGLA
XFF4834R

XFF4834R_chr30370 lcl|XFF4834R_chr32980207_3488842_r3_XFF4834R-XFF4834R_chr30370

3

203

S=213 I=32 E=1.48454e-19

predicted enzyme

XFF4834R

XFF4834R_chr32370 lcl|XFF4834R_chr35050976_3725632_r3_XFF4834R-XFF4834R_chr32370

3

190

S=181 I=32 E=1.03489e-15

XFF4834R

XFF4834R_chr30240 lcl|XFF4834R_chr32850947_3476585_r2_XFF4834R-XFF4834R_chr30240

32

190

S=120 I=30 E=2.35545e-08

XFF4834R

XFF4834R_chr30370 lcl|XFF4834R_chr32980207_3488842_r3_XFF4834R-XFF4834R_chr30370

3

203

S=213 I=32 E=1.48454e-19

predicted enzyme

XFF4834R

XFF4834R_chr32370 lcl|XFF4834R_chr35050976_3725632_r3_XFF4834R-XFF4834R_chr32370

3

190

S=181 I=32 E=1.03489e-15

XFF4834R

XFF4834R_chr30240 lcl|XFF4834R_chr32850947_3476585_r2_XFF4834R-XFF4834R_chr30240

32

190

S=120 I=30 E=2.35545e-08

X.species

NP_641354.1 lcl|gst-XAC1007

1

204

S=1038 I=99 E=6.23312e-119

glutathione S-transferase

X.species

YP_362766.1 lcl|gst2-XCV1035

1

204

S=1032 I=97 E=3.44239e-118

glutathione transferase

X.species

NP_636315.1 lcl|gst-XCC0929

1

203

S=904 I=85 E=9.02628e-103

glutathione S-transferase

X.species

lcl|gst-XALc_0548

1

204

S=678 I=65 E=2.34318e-75

probable glutathione transferase protein

X.species

NP_636791.1 lcl|gst-XCC1418

3

203

S=240 I=34 E=2.81211e-22

glutathione S-transferase

X.species

YP_363249.1 lcl|gst4-XCV1518

3

203

S=222 I=33 E=4.57458e-20

glutathione transferase

X.species

NP_642547.1 lcl|gst-XAC2230

1

201

S=219 I=31 E=1.0473e-19

glutathione S-transferase

X.species

NP_641795.1 lcl|gst-XAC1461

3

203

S=216 I=32 E=2.48275e-19

glutathione S-transferase

X.species

YP_363079.1 lcl|gst3-XCV1348

3

190

S=176 I=31 E=1.46531e-14

glutathione transferase

X.species

NP_641634.1 lcl|gstA-XAC1299

3

190

S=172 I=31 E=4.71326e-14

glutathione S-transferase

X.species

YP_363263.1 lcl|gst5-XCV1532

32

188

S=129 I=31 E=7.25827e-09

glutathione transferase

X.species

NP_642775.1 lcl|gstA-XAC2460

8

190

S=125 I=26 E=2.19644e-08

glutathione S-transferase

X.species

NP_641808.2 lcl|gst-XAC1474

32

190

S=124 I=30 E=3.05919e-08

glutathione S-transferase

X.species

YP_364368.1 lcl|gst-XCV2637

8

190

S=124 I=26 E=3.08598e-08

putative glutathione transferase

X.species

lcl|uptB-XALc_2718

18

103

S=108 I=34 E=2.58784e-06

probable maleylacetoacetate isomerase protein

X.species

NP_636804.1 lcl|gst-XCC1431

32

190

S=106 I=27 E=5.15314e-06

glutathione S-transferase

X.species

NP_637681.1 lcl|gstA-XCC2327

1

105

S=102 I=26 E=1.30987e-05

glutathione S-transferase

X.species

YP_365462.1 lcl|XCV3731

17

103

S=99 I=35 E=3.66467e-05

maleylacetoacetate isomerase

pubmed

1

203

S=904 I=85 E=3.18309e-101

Glutathione S-transferase GST-4.5 EC=2.5.1.18 ; Cytoplasm

Pubmed 8342943

 

prodomImg

pubmed

1

203

S=337 I=42 E=1.75009e-32

BphK ; Plasmid

Pubmed 16244860

 

prodomImg

pubmed

1

203

S=337 I=39 E=1.82807e-32

Glutathione S-transferase (BphK) EC=2.5.1.18 Glutathione S-transferase EC=2.5.1.18

Pubmed 8026764

 

prodomImg

pubmed

1

203

S=336 I=39 E=2.2733e-32

Glutathione S-transferase EC=2.5.1.18

Pubmed 8026764,12770715

 

prodomImg

pubmed

1

203

S=327 I=39 E=2.77577e-31

Glutathione S-transferase

Pubmed 9190809,10900199

 

prodomImg

pubmed

1

199

S=317 I=38 E=4.44112e-30

Glutathione S-transferase EC=2.5.1.18

Pubmed 10537204

 

prodomImg

pubmed

1

203

S=310 I=40 E=2.86949e-29

Glutathione S-transferase

Pubmed 19187202

 

prodomImg

pubmed

1

203

S=298 I=36 E=9.88838e-28

Glutathione S-transferase GST-6.0 EC=2.5.1.18 ; Cytoplasm

Pubmed 8761466,8436105

 

prodomImg

pubmed

1

203

S=296 I=35 E=1.42613e-27

Glutathione S-transferase, C-terminal domain Glutathione-S-transferase-like protein

Pubmed 16461653

 

prodomImg

pubmed

1

203

S=296 I=39 E=1.55605e-27

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

Pubmed 7798255

 

prodomImg

sp

1

203

S=904 I=85 E=2.2044e-101

Glutathione S-transferase GST-4.5 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

1

203

S=353 I=37 E=1.4453e-34

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

1

203

S=298 I=36 E=6.84804e-28

Glutathione S-transferase GST-6.0 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

1

203

S=296 I=39 E=1.07762e-27

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

1

203

S=296 I=39 E=1.07762e-27

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

1

74

Thioredoxin fold

Iprscan IPR010987 [G3DSA:1.20.1050.10]

80

204

Glutathione S-transferase, C-terminal-like

Iprscan [PTHR11260:SF7]

1

170

-

Iprscan [PTHR11260]

1

170

-

Iprscan IPR004046 [PF00043]

124

190

Glutathione S-transferase, C-terminal

Iprscan IPR004045 [PF02798]

1

71

Glutathione S-transferase, N-terminal

Iprscan IPR004045 [PS50404]

1

77

Glutathione S-transferase, N-terminal

Iprscan IPR017933 [PS50405]

83

204

Glutathione S-transferase/chloride channel, C-terminal

Iprscan [SignalP-NN(euk)]

1

32

-

PDA1L0T7

90

142

S=257 I=89 E=1.19475e-23

PDA326R4

70

142

S=172 I=44 E=2.03429e-13

PD292491

3

109

S=147 I=33 E=2.13818e-10

PD732424

1

40

S=132 I=64 E=1.53261e-08

PD600053

34

89

S=107 I=44 E=1.77302e-05

Iprscan IPR010987 [SSF47616]

76

204

Glutathione S-transferase, C-terminal-like

Iprscan IPR012336 [SSF52833]

1

81

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QDN5kET4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

77 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHP4z3F/XFF4834R_chr10130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHP4z3F/XFF4834R_chr10130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHP4z3F/XFF4834R_chr10130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBHP4z3F/XFF4834R_chr10130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.