Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10060XFF4834R_chr_1138168_1139565_f1_XFF4834R-XFF4834R_chr10060XFF4834R_chr10060family II 2-keto-3-deoxy-D-arabino-heptulosonate 7-phosphate synthase

XFF4834R_chr_1138168_1139565_f1_XFF4834R-XFF4834R_chr10060 XFF4834R_chr10060
XFF4834R_chr_1089
XFF4834R_chr_1089
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10070
XFF4834R_chr10070
ID XFF4834R_chr_1138168_1139565_f1_XFF4834R-XFF4834R_chr10060
AC XFF4834R_chr10060
LT XFF4834R_chr10060
OR XFF4834R_chr from 1138168 to 1139565 on strand +
DE family II 2-keto-3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
IP DAHP synthetase, class II
CL 1.5.1 Amino acids GO:0008652
EC
GO InterPro
Biological Process: aromatic amino acid family biosynthetic process (GO:0009073)
Molecular Function: 3-deoxy-7-phosphoheptulonate synthase activity (GO:0003849)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120329)
MW 51626 Da
SQ 465 aa
 
........10........20........30........40........50
| | | | |
MNLSAATSVTDSAAAAWAPDSWRGKPALQLPVYPDENALQAAMHELGRLP
PLVTSWEIFALKRQLAEAQEGKRFLLQGGDCAENFSDCESGTISNRLKVL
LQMSLVLVHGLHLPVVRVGRFAGQYAKPRSADTETRDGVTLPSYRGDVIN
APAFTEAARVPDPRRMITAHSRSAMTMNFVRALIDGGFADLHHPEYWNLD
WVGYSPLAADYQKMVASIGDAVRFMETLSGAEVYNLNRIDFYTSHEALLL
PYEEGLTRQVPRQWGWFNLSTHYPWIGMRTAALDGAHVEYLRGVRNPIAI
KVGPSVQPDQLLRLIDVLNPEDEPGRLSFIHRMGAAQIADKLPPLLDAVK
RDGRRVLWVCDAMHGNTESTGNGYKTRRFDNIRNEVETSFDLHAAAGTRL
GGVHLELTGEDVTECTGGARELTERDLERAYRSSVDPRLNYEQSLEIAMA
IVRKQQQVASQPLGA
X.species

NP_641347.1 lcl|dhs1-XAC1000

23

465

S=2272 I=96 E=0

family II 2-keto-3-deoxy-D-arabino-heptulosonate 7-phosphate synthase

X.species

YP_362759.1 lcl|XCV1028

23

465

S=2267 I=96 E=0

3-deoxy-7-phosphoheptulonate synthase

X.species

NP_636308.2 lcl|dhs1-XCC0922

23

464

S=2163 I=92 E=0

family II 2-keto-3-deoxy-D-arabino-heptulosonate 7-phosphate synthase

X.species

lcl|XALc_0542

23

455

S=2024 I=86 E=0

putative 3-deoxy-7-phosphoheptulonate synthase protein

pubmed

23

465

S=2152 I=91 E=0

Family II 2-keto-3-deoxy-D-arabino-heptulosonate 7-phosphate synthase

Pubmed 11395471

 

prodomImg

pubmed

23

451

S=1045 I=48 E=9.31305e-118

Phospho-2-dehydro-3-deoxyheptonate aldolase EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Transferase

Pubmed 8760910

 

prodomImg

pubmed

23

458

S=1039 I=46 E=5.14336e-117

AroAA5

Pubmed 11029592,10896221

 

prodomImg

pubmed

25

454

S=1033 I=46 E=2.28423e-116

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 1681544

 

prodomImg

pubmed

23

464

S=1006 I=44 E=4.65741e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 7902741

 

prodomImg

pubmed

23

463

S=1004 I=44 E=7.32897e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 1967256

 

prodomImg

pubmed

23

454

S=1004 I=45 E=7.99665e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 16668482

 

prodomImg

pubmed

23

454

S=1003 I=46 E=1.12352e-112

Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 16653023

 

prodomImg

pubmed

23

454

S=1000 I=44 E=2.88087e-112

Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic EC=2.5.1.54 ; Alternative splicing Amino-acid biosynthesis Aromatic Plastid Transfer

Pubmed 1681544

 

prodomImg

pubmed

23

463

S=992 I=45 E=2.25496e-111

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

Pubmed 7902741

 

prodomImg

sp

23

451

S=1045 I=48 E=6.40887e-118

Phospho-2-dehydro-3-deoxyheptonate aldolase EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Transferase

 

prodomImg

sp

25

454

S=1033 I=46 E=1.57191e-116

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

 

prodomImg

sp

23

454

S=1009 I=46 E=1.50109e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

 

prodomImg

sp

23

464

S=1006 I=44 E=3.20504e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

 

prodomImg

sp

23

463

S=1004 I=44 E=5.0435e-113

Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic EC=2.5.1.54 ; Amino-acid biosynthesis Aromatic Plastid Transferase Transit peptide

 

prodomImg

Iprscan IPR002480 [PF01474]

16

452

DAHP synthetase, class II

Iprscan IPR002480 [TIGR01358]

17

459

DAHP synthetase, class II

Iprscan [seg]

4

22

-

Iprscan [seg]

105

119

-

PD001974

29

213

S=456 I=50 E=1.03088e-47

PD860219

266

334

S=255 I=64 E=2.59088e-23

PD860216

382

443

S=193 I=60 E=7.46213e-16

PD856765

338

383

S=162 I=61 E=4.93681e-12

PDA1L3H0

175

207

S=154 I=82 E=4.00136e-11

PD234721

211

256

S=108 I=48 E=1.72396e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one o2SgBi1t)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

17 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTtluUF/XFF4834R_chr10060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTtluUF/XFF4834R_chr10060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTtluUF/XFF4834R_chr10060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTtluUF/XFF4834R_chr10060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.