Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10030rplQXFF4834R_chr10030probable 50S ribosomal protein L17

rplQ XFF4834R_chr10030
XFF4834R_chr10020
XFF4834R_chr10020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10040
XFF4834R_chr10040
ID rplQ
AC XFF4834R_chr10030
LT XFF4834R_chr10030
OR XFF4834R_chr from 1133988 to 1134371 on strand +
DE probable 50S ribosomal protein L17
IP Ribosomal protein L17
CL 2.3.2 Translation GO:0006412
EC
GO InterPro
Biological Process: translation (GO:0006412)
Cellular Component: ribosome (GO:0005840)
Cellular Component: intracellular (GO:0005622)
Molecular Function: structural constituent of ribosome (GO:0003735)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100806)
MW 14316.6 Da
SQ 127 aa
 
........10........20........30........40........50
| | | | |
MRHQKSGRKFNRTSAHREAMFRNMAASLFKHELIKTTLPKAKELRRVAEP
LITIGKVDGVANRRLAFARLRDKEAVGKLFVELGPRYATRPGGYLRILKA
GFRAGDNAPMAYVELVDRPVVAEEVAE
X.species

NP_641344.1 lcl|rplQ-XAC0997

1

127

S=651 I=100 E=1.99015e-72

50S ribosomal protein L17

X.species

NP_636306.1 lcl|rplQ-XCC0920

1

127

S=649 I=99 E=3.05087e-72

50S ribosomal protein L17

X.species

YP_362755.1 lcl|rplQ-XCV1024

1

127

S=642 I=99 E=2.18864e-71

50S ribosomal protein L17

X.species

lcl|rplQ-XALc_0539

1

127

S=614 I=92 E=6.0549e-68

probable 50s ribosomal protein l17

pubmed

1

127

S=649 I=99 E=9.4189e-71

50S ribosomal protein L17 ; Ribonucleoprotein

Pubmed 10899600

 

prodomImg

pubmed

1

125

S=517 I=81 E=1.15574e-54

50S ribosomal protein L17 ; Ribonucleoprotein

Pubmed 10368148

 

prodomImg

pubmed

1

127

S=509 I=76 E=9.20552e-54

50S ribosomal protein L17 ; Ribonucleoprotein

Pubmed 6379605,2989779

 

prodomImg

pubmed

1

125

S=494 I=74 E=6.26205e-52

50S ribosomal protein L17 ; Ribonucleoprotein

Pubmed 17142390

 

prodomImg

pubmed

1

119

S=478 I=75 E=5.20565e-50

50S ribosomal protein L17 ; Ribonucleoprotein

Pubmed 11111034

 

prodomImg

sp

1

127

S=651 I=100 E=4.32013e-71

50S ribosomal protein L17 ; Ribonucleoprotein

 

prodomImg

sp

1

127

S=651 I=100 E=4.32013e-71

50S ribosomal protein L17 ; Ribonucleoprotein

 

prodomImg

sp

1

127

S=651 I=100 E=4.32013e-71

50S ribosomal protein L17 ; Ribonucleoprotein

 

prodomImg

sp

1

127

S=649 I=99 E=6.62271e-71

50S ribosomal protein L17 ; Ribonucleoprotein

 

prodomImg

sp

1

127

S=649 I=99 E=6.62271e-71

50S ribosomal protein L17 ; Ribonucleoprotein

 

prodomImg

Iprscan IPR000456 [G3DSA:3.90.1030.10]

1

117

Ribosomal protein L17

Iprscan IPR000456 [MF_01368]

5

116

Ribosomal protein L17

Iprscan [PTHR14413:SF3]

1

120

-

Iprscan IPR000456 [PTHR14413]

1

120

Ribosomal protein L17

Iprscan IPR000456 [PF01196]

20

116

Ribosomal protein L17

Iprscan IPR000456 [TIGR00059]

6

117

Ribosomal protein L17

Iprscan IPR000456 [PS01167]

34

56

Ribosomal protein L17

PD004277

22

111

S=290 I=70 E=1.20588e-27

PD701245

72

116

S=117 I=49 E=1.05795e-06

Iprscan IPR000456 [SSF64263]

14

117

Ribosomal protein L17

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gGskGyr7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

82 hits
swiss-prot

Swiss-Prot ncbi-blastp

793 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7ug7vc/XFF4834R_chr10030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7ug7vc/XFF4834R_chr10030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7ug7vc/XFF4834R_chr10030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7ug7vc/XFF4834R_chr10030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.