Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10010rpsDXFF4834R_chr10010probable 30S ribosomal protein S4

rpsD XFF4834R_chr10010
XFF4834R_chr10000
XFF4834R_chr10000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10020
XFF4834R_chr10020
ID rpsD
AC XFF4834R_chr10010
LT XFF4834R_chr10010
OR XFF4834R_chr from 1132129 to 1132755 on strand +
DE probable 30S ribosomal protein S4
IP Ribosomal protein S4, bacterial-type
CL 2.3.2 Translation GO:0006412
EC
GO InterPro
Biological Process: translation (GO:0006412)
Cellular Component: intracellular (GO:0005622)
Cellular Component: small ribosomal subunit (GO:0015935)
Molecular Function: rRNA binding (GO:0019843)
Molecular Function: RNA binding (GO:0003723)
Molecular Function: structural constituent of ribosome (GO:0003735)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100806)
MW 23280.6 Da
SQ 208 aa
 
........10........20........30........40........50
| | | | |
MARYIGPTCKLARREGADLSLKSPARALDSKCKLEQKPGQHGAARKGKLS
DYATQLREKQKVKRIYGLLERQFRNYYKKASTKKGNTGENLLQLLETRLD
NVCYRMGFAVTRPAARQLVSHRGVLVNGKSVNLASYQIKAGDAITLSEKA
QKQLRVQEALTVAEQHDMTPSWVEVDSKKFSGVFKAVPDRADLPSDINEA
LIVELYSK
Show or not Domain decomposition
 
X.species

YP_362753.1 lcl|rpsD-XCV1022

1

208

S=1102 I=100 E=1.08186e-126

30S ribosomal protein S4

X.species

NP_636304.1 lcl|rpsD-XCC0918

1

208

S=1102 I=100 E=1.08186e-126

30S ribosomal protein S4

X.species

NP_641342.1 lcl|rpsD-XAC0995

1

208

S=1102 I=100 E=1.08186e-126

30S ribosomal protein S4

X.species

lcl|rpsD-XALc_0537

1

208

S=1043 I=95 E=1.43413e-119

probable 30s ribosomal protein s4

pubmed

1

208

S=1102 I=100 E=4.24054e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 10899600

 

prodomImg

pubmed

1

208

S=738 I=66 E=5.21778e-81

30S ribosomal protein S4 ; Antibiotic resistance Repressor Ribonucleoprotein RNA-binding rRNA-binding Transcription regulation termination Trans

Pubmed 2989779

 

prodomImg

pubmed

1

208

S=734 I=66 E=1.47258e-80

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 17142390

 

prodomImg

pubmed

1

208

S=734 I=66 E=1.67833e-80

30S ribosomal protein S4 ; Antibiotic resistance Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 9520473

 

prodomImg

pubmed

1

208

S=723 I=66 E=2.98143e-79

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 10368148

 

prodomImg

sp

1

208

S=1102 I=100 E=2.89959e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

208

S=1102 I=100 E=2.89959e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

208

S=1102 I=100 E=2.89959e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

208

S=1102 I=100 E=2.89959e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

208

S=1102 I=100 E=2.89959e-125

30S ribosomal protein S4 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

Iprscan [G3DSA:1.10.1050.10]

1

110

-

Iprscan IPR001912 [PF00163]

2

96

Ribosomal protein S4

Iprscan IPR002942 [PF01479]

97

144

RNA-binding S4

Iprscan IPR002942 [SM00363]

97

161

RNA-binding S4

Iprscan IPR005709 [TIGR01017]

3

208

Ribosomal protein S4, bacterial-type

Iprscan IPR018079 [PS00632]

95

119

Ribosomal protein S4, conserved site

Iprscan IPR002942 [PS50889]

97

160

RNA-binding S4

PD004849

10

201

S=403 I=46 E=2.34258e-41

PD499781

91

155

S=129 I=42 E=3.40334e-08

Iprscan [SSF55174]

2

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Sz4bFED6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

892 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkNeUzo/XFF4834R_chr10010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkNeUzo/XFF4834R_chr10010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkNeUzo/XFF4834R_chr10010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkNeUzo/XFF4834R_chr10010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.