Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10000rpsKXFF4834R_chr10000probable 30S ribosomal protein S11

rpsK XFF4834R_chr10000
XFF4834R_chr09990
XFF4834R_chr09990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10010
XFF4834R_chr10010
ID rpsK
AC XFF4834R_chr10000
LT XFF4834R_chr10000
OR XFF4834R_chr from 1131721 to 1132113 on strand +
DE probable 30S ribosomal protein S11
IP Ribosomal protein S11
CL 2.3.2 Translation GO:0006412
EC
GO InterPro
Biological Process: translation (GO:0006412)
Cellular Component: intracellular (GO:0005622)
Cellular Component: ribosome (GO:0005840)
Molecular Function: structural constituent of ribosome (GO:0003735)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100806)
MW 13915 Da
SQ 130 aa
 
........10........20........30........40........50
| | | | |
MAKPAEKKTKKKIKRVITDGVAHVHASFNNTIVTITDRQGNALSWATSGG
AGFRGSRKSTPFAAQVAAEKAGRAALDYGVKSLEVRIKGPGPGRESAVRS
LNNVGYKITNIIDVTPIPHNGCRPPKKRRV
X.species

YP_362752.1 lcl|rpsK-XCV1021

1

130

S=606 I=91 E=5.23768e-67

30S ribosomal protein S11

X.species

NP_636303.1 lcl|XCC0917

1

130

S=606 I=91 E=5.23768e-67

30S ribosomal protein S11

X.species

NP_641341.1 lcl|rpsK-XAC0994

1

130

S=606 I=91 E=5.23768e-67

30S ribosomal protein S11

X.species

lcl|rpsK-XALc_0536

1

130

S=605 I=90 E=7.10667e-67

probable 30s ribosomal protein s11

pubmed

1

130

S=606 I=91 E=1.68957e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 10899600

 

prodomImg

pubmed

17

127

S=517 I=85 E=1.05463e-54

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 11111034

 

prodomImg

pubmed

17

130

S=497 I=78 E=2.67628e-52

30S ribosomal protein S11 ; Methylation Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 2989779

 

prodomImg

pubmed

17

130

S=497 I=78 E=2.69972e-52

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 9520473

 

prodomImg

pubmed

15

130

S=497 I=78 E=3.24216e-52

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

Pubmed 15716086

 

prodomImg

sp

1

130

S=606 I=91 E=1.18384e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

130

S=606 I=91 E=1.18384e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

130

S=606 I=91 E=1.18384e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

130

S=606 I=91 E=1.18384e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

sp

1

130

S=606 I=91 E=1.18384e-65

30S ribosomal protein S11 ; Ribonucleoprotein RNA-binding rRNA-binding

 

prodomImg

Iprscan IPR001971 [G3DSA:3.30.420.80]

4

129

Ribosomal protein S11

Iprscan IPR001971 [PIRSF002131]

1

130

Ribosomal protein S11

Iprscan [PTHR11759:SF3]

9

130

-

Iprscan IPR001971 [PTHR11759]

9

130

Ribosomal protein S11

Iprscan IPR001971 [PF00411]

20

129

Ribosomal protein S11

Iprscan IPR019981 [TIGR03632]

11

127

Ribosomal protein S11, bacterial-type

Iprscan IPR018102 [PS00054]

98

120

Ribosomal S11, conserved site

Iprscan [seg]

3

14

-

PDA814L4

21

106

S=192 I=36 E=9.16073e-16

PD888067

20

130

S=167 I=30 E=9.21782e-13

PD455132

23

107

S=139 I=41 E=1.91252e-09

PDA1U1P5

77

127

S=135 I=45 E=7.51775e-09

PD001010

32

62

S=117 I=61 E=9.92044e-07

PD889150

106

130

S=109 I=80 E=1.02639e-05

Iprscan [SSF53137]

14

130

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aXtHPU3A)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

307 hits
swiss-prot

Swiss-Prot ncbi-blastp

984 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCnPDBO/XFF4834R_chr10000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCnPDBO/XFF4834R_chr10000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCnPDBO/XFF4834R_chr10000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCnPDBO/XFF4834R_chr10000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.