Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09990rpsMXFF4834R_chr09990probable 30S ribosomal protein S13

rpsM XFF4834R_chr09990
XFF4834R_chr09980
XFF4834R_chr09980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10000
XFF4834R_chr10000
ID rpsM
AC XFF4834R_chr09990
LT XFF4834R_chr09990
OR XFF4834R_chr from 1131354 to 1131710 on strand +
DE probable 30S ribosomal protein S13
IP Ribosomal protein S13; Ribosomal protein S13-like, H2TH
CL 2.3.2 Translation GO:0006412
EC
GO InterPro
Biological Process: translation (GO:0006412)
Cellular Component: intracellular (GO:0005622)
Cellular Component: ribosome (GO:0005840)
Molecular Function: RNA binding (GO:0003723)
Molecular Function: structural constituent of ribosome (GO:0003735)
Molecular Function: nucleic acid binding (GO:0003676)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100806)
MW 13374.6 Da
SQ 118 aa
 
........10........20........30........40........50
| | | | |
MARIAGVNLPAQKHVWVGLQSIYGIGRTRSKKLCESAGVTSTTKIRDLSE
PEIERLRAEVGKYVVEGDLRREIGIAIKRLMDLGCYRGLRHRRGLPLRGQ
RTRTNARTRKGPRKAIRK
Show or not Domain decomposition
 
X.species

NP_636302.1 lcl|rpsM-XCC0916

1

118

S=507 I=87 E=4.39121e-55

30S ribosomal protein S13

X.species

YP_362751.1 lcl|rpsM-XCV1020

1

118

S=506 I=87 E=5.6054e-55

30S ribosomal protein S13

X.species

NP_641340.1 lcl|rpsM-XAC0993

1

118

S=506 I=87 E=5.6054e-55

30S ribosomal protein S13

X.species

lcl|rpsM-XALc_0535

1

118

S=489 I=83 E=7.527e-53

probable 30s ribosomal protein s13

pubmed

1

118

S=507 I=87 E=1.2513e-53

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

Pubmed 10899600

 

prodomImg

pubmed

1

118

S=341 I=57 E=1.62658e-33

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

Pubmed 2989779

 

prodomImg

pubmed

1

118

S=328 I=53 E=6.79046e-32

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

Pubmed 11111034

 

prodomImg

pubmed

1

116

S=313 I=55 E=4.23353e-30

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

Pubmed 19145256

 

prodomImg

pubmed

1

117

S=301 I=52 E=1.16299e-28

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

Pubmed 15716086

 

prodomImg

sp

1

118

S=507 I=87 E=8.90056e-54

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

 

prodomImg

sp

1

118

S=506 I=87 E=1.13616e-53

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

 

prodomImg

sp

1

118

S=506 I=87 E=1.13616e-53

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

 

prodomImg

sp

1

118

S=506 I=87 E=1.13616e-53

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

 

prodomImg

sp

1

118

S=506 I=87 E=1.13616e-53

30S ribosomal protein S13 ; Ribonucleoprotein RNA-binding rRNA-binding tRNA-binding

 

prodomImg

Iprscan [G3DSA:1.10.8.50]

1

71

-

Iprscan [G3DSA:4.10.910.10]

72

116

-

Iprscan IPR001892 [PIRSF002134]

1

118

Ribosomal protein S13

Iprscan [PTHR10871:SF1]

1

118

-

Iprscan [PTHR10871]

1

118

-

Iprscan IPR001892 [PF00416]

3

108

Ribosomal protein S13

Iprscan IPR019980 [TIGR03631]

3

114

Ribosomal protein S13, bacterial-type

Iprscan IPR018269 [PS00646]

87

100

Ribosomal protein S13, conserved site

Iprscan IPR001892 [PS50159]

4

111

Ribosomal protein S13

Iprscan [seg]

87

101

-

PDA1E1P1

31

73

S=125 I=52 E=1.00734e-07

PD001363

73

118

S=102 I=48 E=6.16656e-05

Iprscan IPR010979 [SSF46946]

2

118

Ribosomal protein S13-like, H2TH

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5Vg25lV5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

108 hits
swiss-prot

Swiss-Prot ncbi-blastp

777 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4agf75/XFF4834R_chr09990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4agf75/XFF4834R_chr09990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4agf75/XFF4834R_chr09990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4agf75/XFF4834R_chr09990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.