Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09510hemAXFF4834R_chr09510probable glutamyl-tRNA reductase

hemA XFF4834R_chr09510
XFF4834R_chr09500
XFF4834R_chr09500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09520
XFF4834R_chr09520
ID hemA
AC XFF4834R_chr09510
LT XFF4834R_chr09510
OR XFF4834R_chr from 1092255 to 1093553 on strand -
DE probable glutamyl-tRNA reductase
IP Tetrapyrrole biosynthesis, glutamyl-tRNA reductase; Ornithine cyclodeaminase/mu-crystallin; Quinate/shikimate 5-dehydrogenase/glutamyl-tRNA reductase; Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, N-terminal; Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, C-terminal
CL 1.5.3.12 Heme, porphyrin GO:0006783 GO:0006779
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: tetrapyrrole biosynthetic process (GO:0033014)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glutamyl-tRNA reductase activity (GO:0008883)
Molecular Function: shikimate 5-dehydrogenase activity (GO:0004764)
Molecular Function: NADP or NADPH binding (GO:0050661)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 47214.9 Da
SQ 432 aa
 
........10........20........30........40........50
| | | | |
MTLWVLGLNHQSAPVDLRERAAFAGDALPRALESLRALPQVSEAALLSTC
NRTELYAMAEEAHSLVNWLETHAPGLSGYLYQHQEAEAVRHLFRVATGLD
SMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTFSVAKRARTDTRV
GANPVSVASTAVRLAQDSFARLNESTVLLIGAGETIELAAKHLSEGRVRR
LLIANRTLAHAQTLASQHGGFALPLTDLERHLAEADVVFSATAAREPLVT
RAQVEQALRARKRKPMLLFDLAVPRDIEASVGELSDAYLYTVDDLERAVE
DNRRGRREAADQAEAIIDLQVARYVETLQATARQAPLKRLRAFGDSTRDE
LLTKARQQLHNGKPADEVLEQLAHALTNRLLHPPTAALRDAALNNDLELT
AAADRLFPEKPGYQHPPIATPIVRTDDADPAP
X.species

YP_362707.1 lcl|hemA-XCV0976

1

432

S=2104 I=95 E=0

glutamyl-tRNA reductase

X.species

NP_641297.1 lcl|hemA-XAC0945

1

421

S=2043 I=95 E=0

glutamyl-tRNA reductase

X.species

NP_636259.1 lcl|hemA-XCC0868

1

432

S=1988 I=89 E=0

glutamyl-tRNA reductase

X.species

lcl|hemA-XALc_0487

1

432

S=1667 I=78 E=0

probable glutamyl-trna reductase (glutr) protein

pubmed

1

421

S=1999 I=93 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 7764570

 

prodomImg

pubmed

1

415

S=1305 I=66 E=2.84856e-149

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 19218412

 

prodomImg

pubmed

1

412

S=896 I=47 E=8.94992e-100

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 7883699

 

prodomImg

pubmed

1

385

S=882 I=46 E=4.56597e-98

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 8549730

 

prodomImg

pubmed

1

385

S=878 I=48 E=1.33436e-97

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 2544564

 

prodomImg

pubmed

1

385

S=876 I=49 E=2.63403e-97

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 9811666

 

prodomImg

pubmed

1

385

S=872 I=48 E=6.81317e-97

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 2684779,2548996

 

prodomImg

pubmed

1

385

S=844 I=48 E=1.80447e-93

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 9811666

 

prodomImg

pubmed

1

384

S=716 I=39 E=6.25412e-78

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 16914272,17906152

 

prodomImg

pubmed

1

385

S=705 I=40 E=1.14044e-76

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

Pubmed 17240088

 

prodomImg

sp

1

432

S=2104 I=95 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

 

prodomImg

sp

1

432

S=2086 I=94 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

 

prodomImg

sp

1

432

S=2086 I=94 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

 

prodomImg

sp

1

432

S=2082 I=94 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

 

prodomImg

sp

1

421

S=2043 I=95 E=0

Glutamyl-tRNA reductase EC=1.2.1.70 ; NADP Oxidoreductase Porphyrin biosynthesis

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

153

305

NAD(P)-binding domain

Iprscan IPR000343 [PIRSF000445]

1

411

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase

Iprscan IPR003462 [PTHR13812]

164

254

Ornithine cyclodeaminase/mu-crystallin

Iprscan IPR015895 [PF05201]

6

148

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, N-terminal

Iprscan IPR006151 [PF01488]

164

297

Quinate/shikimate 5-dehydrogenase/glutamyl-tRNA reductase

Iprscan IPR015896 [PF00745]

312

407

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, C-terminal

Iprscan IPR000343 [TIGR01035]

3

410

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase

Iprscan [seg]

386

399

-

PD001191

83

166

S=286 I=64 E=3.67361e-27

PD120857

227

302

S=217 I=53 E=7.99793e-19

PD603521

1

84

S=168 I=48 E=6.56898e-13

PDA376S3

61

86

S=142 I=100 E=1.19586e-09

PDA12814

332

385

S=132 I=48 E=1.93007e-08

PDA1X3D3

408

432

S=125 I=92 E=1.21486e-07

PDA00684

169

319

S=122 I=25 E=3.19763e-07

Iprscan IPR015895 [SSF69742]

1

150

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, N-terminal

Iprscan IPR016040 [SSF51735]

155

308

NAD(P)-binding domain

Iprscan IPR015896 [SSF69075]

309

411

Tetrapyrrole biosynthesis, glutamyl-tRNA reductase, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jovm2y1i)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

53 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsEXy2F/XFF4834R_chr09510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsEXy2F/XFF4834R_chr09510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsEXy2F/XFF4834R_chr09510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsEXy2F/XFF4834R_chr09510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.