Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09410XFF4834R_chr10010252_1083596_r2_XFF4834R-XFF4834R_chr09410XFF4834R_chr09410putative membrane protein

XFF4834R_chr10010252_1083596_r2_XFF4834R-XFF4834R_chr09410 XFF4834R_chr09410
XFF4834R_chr_1024
XFF4834R_chr_1024
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09420
XFF4834R_chr09420
ID XFF4834R_chr10010252_1083596_r2_XFF4834R-XFF4834R_chr09410
AC XFF4834R_chr09410
LT XFF4834R_chr09410
OR XFF4834R_chr from 1083252 to 1083581 on strand -
DE putative membrane protein
IP Protein of unknown function DUF2069, membrane
CL 7.3 Inner membrane GO:0005886
EC
GO InterPro


Curated
PM
AN 5 codons deleted to fit to other xanthomonads and to give better signal sequence. Confirmed by Phobius.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100721)
MW 11649.8 Da
SQ 109 aa
 
........10........20........30........40........50
| | | | |
MHWLLSAALLALAALFAVWFHDDPRPLAALIVFVPPAALTGVLAVRSARA
RFWAGVFALGWFSHGVMAAWSQPQARGMAWLELLLALAVVGLVGGPGMAA
RLGRTRPPR
XFF4834R

YP_362697.1 lcl|XCV0966

1

109

S=295 I=62 E=1.96459e-29

hypothetical protein

XFF4834R

NP_641287.1 lcl|XAC0935-XAC0935

18

109

S=292 I=71 E=3.91207e-29

hypothetical protein

XFF4834R

NP_636249.1 lcl|XCC0858

19

109

S=199 I=51 E=8.95203e-18

hypothetical protein

XFF4834R

lcl|XALc_0478

18

76

S=149 I=57 E=1.02407e-11

hypothetical protein

Iprscan IPR018643 [PF09842]

4

89

Protein of unknown function DUF2069, membrane

Iprscan [seg]

4

17

-

Iprscan [seg]

77

100

-

Iprscan [SignalP-NN(euk)]

1

19

-

Iprscan [tmhmm]

2

21

-

Iprscan [tmhmm]

26

45

-

Iprscan [tmhmm]

52

71

-

Iprscan [tmhmm]

81

103

-

PD598331

18

109

S=277 I=67 E=4.07986e-26

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one S4QR8KtF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPYM_5I/XFF4834R_chr09410.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPYM_5I/XFF4834R_chr09410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPYM_5I/XFF4834R_chr09410.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPYM_5I/XFF4834R_chr09410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.