Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09250XFF4834R_chr09840571_1066290_f1_XFF4834R-XFF4834R_chr09250XFF4834R_chr09250putative transcriptional regulator

XFF4834R_chr09840571_1066290_f1_XFF4834R-XFF4834R_chr09250 XFF4834R_chr09250
XFF4834R_chr09250
XFF4834R_chr09250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1006
XFF4834R_chr_1006
ID XFF4834R_chr09840571_1066290_f1_XFF4834R-XFF4834R_chr09250
AC XFF4834R_chr09250
LT XFF4834R_chr09250
OR XFF4834R_chr from 1065691 to 1066290 on strand +
DE putative transcriptional regulator
IP Transcription regulator, pyrimidine utilisation, RutR
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
Biological Process: regulation of transcription (GO:0045449)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN 40 codons deleted because not conserved in Xcc and not possible due to in-frame stop codon in Xac.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100721)
MW 21465.5 Da
SQ 199 aa
 
........10........20........30........40........50
| | | | |
MPTSSTTAAYHHGDLPAALRRAGWDLLGESGLRGLTLRACARRAGVSHAA
PAHHFGSLDGLLADVAADGYERMLARILATQREVDDPLMGCGLGYIRFAL
EFPQHFRLMLGLDVRALRWPRLTEASAAAMACLRETVRAQWIARHATDPG
AALLEQRTVLAWSAVHGYASLAIDGKHEALLGVAPELVFAPLLKGLFEP
Show or not Domain decomposition
 
XFF4834R

NP_641269.1 lcl|XAC0917-XAC0917

1

199

S=995 I=98 E=9.66971e-114

transcriptional regulator

XFF4834R

NP_636235.1 lcl|XCC0844

4

199

S=686 I=66 E=2.76389e-76

transcriptional regulator

pubmed

6

109

S=150 I=36 E=7.91918e-10

Putative transcriptional regulator ; DNA-binding regulation

Pubmed 12730200

 

prodomImg

pubmed

10

167

S=143 I=26 E=6.14482e-09

Predicted transcriptional regulator, AcrR family protein ; DNA-binding regulation

Pubmed 10988064

 

prodomImg

pubmed

10

175

S=109 I=31 E=7.74986e-05

Transcriptional regulator ; DNA-binding regulation

Pubmed 15797213

 

prodomImg

Iprscan IPR012287 [G3DSA:1.10.10.60]

16

76

Homeodomain-related

Iprscan IPR001647 [PF00440]

22

64

Transcription regulator, TetR-like, DNA-binding, bacterial/archaeal

Iprscan IPR001647 [PS50977]

13

73

Transcription regulator, TetR-like, DNA-binding, bacterial/archaeal

PDA4X585

176

199

S=117 I=100 E=1.04854e-06

PDA8T2N4

8

198

S=102 I=23 E=7.4505e-05

Iprscan IPR009057 [SSF46689]

3

88

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one u8TggdEH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjt5OCG/XFF4834R_chr09250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjt5OCG/XFF4834R_chr09250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjt5OCG/XFF4834R_chr09250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjt5OCG/XFF4834R_chr09250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.