Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09150pipXFF4834R_chr09150putative proline iminopeptidase

pip XFF4834R_chr09150
XFF4834R_chr09140
XFF4834R_chr09140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09160
XFF4834R_chr09160
ID pip
AC XFF4834R_chr09150
LT XFF4834R_chr09150
OR XFF4834R_chr from 1054106 to 1055047 on strand +
DE putative proline iminopeptidase
IP Alpha/beta hydrolase fold-1; Peptidase S33, proline iminopeptidase 1
CL 1.1.2.2 3-phenylpropionate and 3-(3-hydroxyphenyl)propionate degradation GO:0019380 GO:0019622
EC
GO InterPro
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: aminopeptidase activity (GO:0004177)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100504)
MW 35496.6 Da
SQ 313 aa
 
........10........20........30........40........50
| | | | |
MRTLYPEITPYQQGSLKVDDRHTLYFEQCGNPQGKPVVMLHGGPGGGCND
KMRRFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLRTHLG
IDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEG
ASRLFPDAWEHYLNAIPPVERADLMSAFHRRLTSDDQATRLAAAKAWSVW
EGATSFLHVDEDFVTGHEDARFALAFARIENHYFVNGGFFEVEDQLLRDA
HRIADIPGVIVHGRYDVVCPLQSAWDLHKAWPKAQLQISPASGHSAFEPE
NVDALVRATDGFA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr16470 lcl|XFF4834R_chr17720584_1903525_f2_XFF4834R-XFF4834R_chr16470

36

132

S=121 I=35 E=3.26078e-08

XFF4834R

XFF4834R_chr16030 lcl|XFF4834R_chr17240879_1851874_r3_XFF4834R-XFF4834R_chr16030

30

132

S=98 I=32 E=2.10334e-05

XFF4834R

XFF4834R_chr16470 lcl|XFF4834R_chr17720584_1903525_f2_XFF4834R-XFF4834R_chr16470

36

132

S=121 I=35 E=3.26078e-08

XFF4834R

XFF4834R_chr16030 lcl|XFF4834R_chr17240879_1851874_r3_XFF4834R-XFF4834R_chr16030

30

132

S=98 I=32 E=2.10334e-05

X.species

NP_641261.1 lcl|pip-XAC0909

1

313

S=1653 I=99 E=0

proline imino-peptidase, chain A

X.species

YP_362676.1 lcl|pip-XCV0945

1

313

S=1617 I=96 E=0

putative proline imino-peptidase

X.species

NP_636227.1 lcl|pip-XCC0836

1

313

S=1531 I=90 E=1.83502e-178

proline iminopeptidase chain A

X.species

lcl|pip-XALc_0462

1

313

S=1454 I=87 E=4.06195e-169

probable proline iminopeptidase (pip) protein

X.species

NP_638165.1 lcl|XCC2817

36

132

S=130 I=35 E=1.13321e-08

proline imino-peptidase

X.species

YP_364865.1 lcl|pip-XCV3134

36

132

S=122 I=34 E=9.42829e-08

prolyl aminopeptidase

X.species

NP_643296.1 lcl|XAC2987-XAC2987

36

132

S=121 I=35 E=1.26816e-07

proline imino-peptidase

X.species

lcl|XALc_3006

21

136

S=116 I=28 E=4.81403e-07

hypothetical hydrolase precursor protein

X.species

NP_643678.1 lcl|XAC3371-XAC3371

23

125

S=102 I=31 E=2.2905e-05

proline imino-peptidase

pubmed

1

313

S=1597 I=96 E=0

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 8885412,8870654

 

prodomImg

pubmed

1

313

S=922 I=57 E=3.90425e-103

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 9348090,11011150

 

prodomImg

pubmed

4

313

S=802 I=51 E=1.58443e-88

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12823802

 

prodomImg

pubmed

4

310

S=771 I=50 E=7.9303e-85

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 7934933

 

prodomImg

pubmed

31

309

S=721 I=51 E=1.07063e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=717 I=51 E=2.69781e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=716 I=51 E=3.59721e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=713 I=51 E=9.71912e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=712 I=51 E=1.06974e-77

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=712 I=51 E=1.15706e-77

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

sp

1

313

S=1597 I=96 E=0

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

 

prodomImg

sp

1

312

S=1415 I=82 E=5.29539e-163

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

 

prodomImg

sp

1

313

S=1397 I=80 E=8.39185e-161

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

 

prodomImg

sp

1

313

S=1039 I=64 E=1.98734e-117

Probable proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

 

prodomImg

sp

2

310

S=977 I=60 E=6.29998e-110

Proline iminopeptidase EC=3.4.11.5 ; Alternative splicing Aminopeptidase Cytoplasm Hydrolase Protease

 

prodomImg

PD011214

9

313

S=873 I=56 E=2.60376e-98

PD330619

22

132

S=157 I=36 E=1.72336e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gTdLEG3b)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

51 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzJDSna/XFF4834R_chr09150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzJDSna/XFF4834R_chr09150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzJDSna/XFF4834R_chr09150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzJDSna/XFF4834R_chr09150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.