Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr09090talBXFF4834R_chr09090probable transaldolase B

talB XFF4834R_chr09090
XFF4834R_chr_0986
XFF4834R_chr_0986
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09100
XFF4834R_chr09100
ID talB
AC XFF4834R_chr09090
LT XFF4834R_chr09090
OR XFF4834R_chr from 1047488 to 1048456 on strand -
DE probable transaldolase B
IP Transaldolase
CL 1.3.2 Pentose phosphate shunt, oxidative branch GO:0009051
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: pentose-phosphate shunt (GO:0006098)
Biological Process: metabolic process (GO:0008152)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: transaldolase activity (GO:0004801)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 34656 Da
SQ 322 aa
 
........10........20........30........40........50
| | | | |
MTASPSKLAQLRELSVVVADTGDYDAIKRLKPVDCTTNPTLVKKALDLPV
YADLIERELAWGREHGGDDRTATVNEVADRLTIGVGVKLAELVPGRVSTE
VDADLAHDTQATIAKARKFIEMYAERGVSKDKILIKIAATWEGIEAARQL
QKEGIDCNLTLIFNRSQALACAEAGVFLISPFVGRILDYYVAQGQTPASI
DEDPGVVFVRTVYNEFKQRGSSTVVMGASFRSTAQIEALAGCDRLTISPD
LLEKLDAEDGELPRKLSPAQADNAQFTPIDSDSFASGLAADPMATEKLAG
GIDTFAKDLQALRKTIADKLAG
X.species

NP_641254.1 lcl|talB-XAC0902

1

322

S=1664 I=99 E=0

transaldolase B

X.species

YP_362670.1 lcl|talB-XCV0939

1

322

S=1657 I=98 E=0

transaldolase B

X.species

NP_636221.1 lcl|talB-XCC0830

1

322

S=1531 I=90 E=1.70087e-178

transaldolase B

X.species

lcl|tal-XALc_0457

1

322

S=1333 I=80 E=1.68172e-154

probable transaldolase protein

pubmed

1

322

S=1629 I=97 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

Pubmed 12359249

 

prodomImg

pubmed

7

320

S=803 I=51 E=1.14873e-88

Transaldolase B EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

Pubmed 7592346,1630901

 

prodomImg

pubmed

10

320

S=803 I=51 E=1.35569e-88

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

Pubmed 10418139

 

prodomImg

pubmed

8

307

S=758 I=51 E=3.40187e-83

Transaldolase EC=2.2.1.2 ; Calcium Cytoplasm Pentose shunt Repeat Transferase

Pubmed 8616240

 

prodomImg

pubmed

8

307

S=755 I=51 E=9.27184e-83

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

Pubmed 8616240

 

prodomImg

sp

1

322

S=1664 I=99 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

 

prodomImg

sp

1

322

S=1657 I=98 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

 

prodomImg

sp

1

322

S=1578 I=93 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

 

prodomImg

sp

1

322

S=1574 I=93 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

 

prodomImg

sp

1

322

S=1574 I=93 E=0

Transaldolase EC=2.2.1.2 ; Cytoplasm Pentose shunt Transferase

 

prodomImg

Iprscan IPR013785 [G3DSA:3.20.20.70]

5

320

Aldolase-type TIM barrel

Iprscan IPR004730 [MF_00492]

5

320

Transaldolase AB

Iprscan IPR004730 [PTHR10683:SF3]

1

320

Transaldolase AB

Iprscan IPR001585 [PTHR10683]

1

320

Transaldolase

Iprscan IPR001585 [PF00923]

17

316

Transaldolase

Iprscan IPR004730 [TIGR00874]

6

320

Transaldolase AB

Iprscan IPR018225 [PS00958]

133

150

Transaldolase, active site

Iprscan IPR018225 [PS01054]

34

42

Transaldolase, active site

PD692808

20

152

S=237 I=44 E=2.89023e-21

PD440958

226

320

S=217 I=52 E=7.59467e-19

PD480825

159

212

S=131 I=53 E=2.0349e-08

PDA0C8H3

137

255

S=128 I=33 E=5.03895e-08

PD696176

95

174

S=111 I=34 E=6.70764e-06

PDA1Y4B7

30

153

S=108 I=27 E=1.34738e-05

Iprscan [SSF51569]

5

320

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y5ELBNnZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

50 hits
swiss-prot

Swiss-Prot ncbi-blastp

473 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi4c8qr/XFF4834R_chr09090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi4c8qr/XFF4834R_chr09090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi4c8qr/XFF4834R_chr09090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi4c8qr/XFF4834R_chr09090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.