Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08660apaGXFF4834R_chr08660probable protein ApaG, associated with Co2+ and Mg2+ efflux

apaG XFF4834R_chr08660
XFF4834R_chr08650
XFF4834R_chr08650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08670
XFF4834R_chr08670
ID apaG
AC XFF4834R_chr08660
LT XFF4834R_chr08660
OR XFF4834R_chr from 1006411 to 1006794 on strand -
DE probable protein ApaG, associated with Co2+ and Mg2+ efflux
IP ApaG
CL 4.S.121 Mg2+/Ni2+/Co2+ GO:0015675 GO:0006824 GO:0015693 GO:0015099 GO:0015087 GO:0015095
EC
GO InterPro


Curated
PM
AN existence of the protein demonstrated for X. a. pv. citri but function not demonstrated
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100629)
MW 14195.7 Da
SQ 127 aa
 
........10........20........30........40........50
| | | | |
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLIAR
HWQITDGNGRTEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGH
YDMVADDGTEFIAPIAAFVLSVPRTLH
X.species

YP_362630.1 lcl|apaG-XCV0899

1

127

S=670 I=100 E=1.08282e-74

ApaG

X.species

NP_641214.1 lcl|apaG-XAC0862

1

127

S=668 I=99 E=1.68915e-74

ApaG

X.species

NP_636181.1 lcl|apaG-XCC0790

1

127

S=639 I=95 E=6.5086e-71

ApaG

X.species

lcl|apaG-XALc_2765

1

127

S=517 I=76 E=3.09016e-56

probable protein apag

pubmed

1

127

S=668 I=99 E=5.21487e-73

Protein ApaG

Pubmed 15213450

 

prodomImg

pubmed

8

127

S=325 I=48 E=2.19934e-31

Protein ApaG

Pubmed 3031429,1630901

 

prodomImg

pubmed

9

127

S=275 I=46 E=2.04091e-25

Protein ApaG

Pubmed 9885190

 

prodomImg

pubmed

9

123

S=243 I=40 E=1.55236e-21

Protein ApaG

Pubmed 19307581

 

prodomImg

pubmed

29

127

S=198 I=39 E=5.47296e-16

Putative uncharacterized protein

Pubmed 18328084

 

prodomImg

sp

1

127

S=670 I=100 E=2.35054e-73

Protein ApaG

 

prodomImg

sp

1

127

S=668 I=99 E=3.66673e-73

Protein ApaG

 

prodomImg

sp

1

127

S=654 I=98 E=1.87065e-71

Protein ApaG

 

prodomImg

sp

1

127

S=654 I=98 E=1.87065e-71

Protein ApaG

 

prodomImg

sp

1

127

S=654 I=98 E=1.87065e-71

Protein ApaG

 

prodomImg

Iprscan IPR007474 [G3DSA:2.60.40.1470]

7

126

ApaG

Iprscan [PTHR14289]

8

123

-

Iprscan IPR007474 [PF04379]

19

106

ApaG

Iprscan IPR007474 [PS51087]

3

127

ApaG

PD031761

10

127

S=364 I=58 E=1.18361e-36

PD332781

9

111

S=120 I=34 E=4.0546e-07

PDA9Y4K1

46

127

S=119 I=32 E=6.54946e-07

Iprscan IPR007474 [SSF110069]

4

127

ApaG

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ig5QT86c)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

188 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpF3Mzu/XFF4834R_chr08660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpF3Mzu/XFF4834R_chr08660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpF3Mzu/XFF4834R_chr08660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpF3Mzu/XFF4834R_chr08660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.