Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08410XFF4834R_chr09020264_0980535_f1_XFF4834R-XFF4834R_chr08410XFF4834R_chr08410putative two-component system sensor protein

XFF4834R_chr09020264_0980535_f1_XFF4834R-XFF4834R_chr08410 XFF4834R_chr08410
XFF4834R_chr08400
XFF4834R_chr08400
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08420
XFF4834R_chr08420
ID XFF4834R_chr09020264_0980535_f1_XFF4834R-XFF4834R_chr08410
AC XFF4834R_chr08410
LT XFF4834R_chr08410
OR XFF4834R_chr from 979264 to 980535 on strand +
DE putative two-component system sensor protein
IP Signal transduction histidine kinase, core; Signal transduction histidine kinase, homodimeric
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: membrane (GO:0016020)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: ATP binding (GO:0005524)
transferring phosphorus-containing groups (GO:0016772)

Curated
PM
AN
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20100819)
MW 46974.3 Da
SQ 423 aa
 
........10........20........30........40........50
| | | | |
MPHGLPRKIRLAFLLQVALASLALVLAGYLVSFVIKYSLVRTVLADEAVH
FWQMQKSAPDNRPPNTRNIQGYFSPTGTADEAAPAALRHLSPGFSEVAAA
DALVYVDHRPEGRLYLVFPRSRAAHLTLWFGVVPAIVVLVAIYGVSWFTY
RVSKRLVSPISWLARRVSHWDPRNPDVDELAPERLPAELQGETRQLAAAL
HALGLRVSEHVARERNFTRDASHELRTPLTVIRVASDMALADDELSARTQ
RSLRRIQRAGHDMEAVIDAFLILAREAEIDPQSENFDVAELASEELESAR
ELLGDKPVSLRMVGDRSLQMFAPPRVMRVVLSNLLRNACAYTDTGSIEVE
VTHDRIVVRDTGIGMSEEARARAFEPFFRADPTRPQGTGLGLSIVRRLCD
RFGWRIELQSEAGVGTSVAVVVA
XFF4834R

XFF4834R_chr13870 lcl|XFF4834R_chr14720552_1587886_f2_XFF4834R-XFF4834R_chr13870

145

409

S=325 I=35 E=9.41453e-33

XFF4834R

XFF4834R_chr33180 lcl|XFF4834R_chr35850933_3814249_r3_XFF4834R-XFF4834R_chr33180

84

411

S=233 I=29 E=1.25473e-21

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

208

403

S=165 I=30 E=2.39683e-13

XFF4834R

XFF4834R_chr32530 lcl|XFF4834R_chr35200757_3745873_f2_XFF4834R-XFF4834R_chr32530

216

411

S=138 I=29 E=4.32545e-10

XFF4834R

XFF4834R_chr24780 lcl|XFF4834R_chr27100302_2863396_f2_XFF4834R-XFF4834R_chr24780

200

410

S=138 I=27 E=4.97296e-10

XFF4834R

XFF4834R_chr16090 lcl|XFF4834R_chr17300019_1859594_f3_XFF4834R-XFF4834R_chr16090

195

411

S=130 I=29 E=3.7591e-09

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

179

411

S=128 I=27 E=6.62532e-09

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr09040 lcl|XFF4834R_chr09630140_1044050_r2_XFF4834R-XFF4834R_chr09040

139

410

S=125 I=28 E=1.55699e-08

XFF4834R

XFF4834R_chr10450 lcl|phoR-XFF4834R_chr10450

215

411

S=122 I=23 E=4.31823e-08

sensory histidine kinase in two-component regulatory system with PhoB

XFF4834R

XFF4834R_chr11650 lcl|XFF4834R_chr12140989_1302374_f3_XFF4834R-XFF4834R_chr11650

179

410

S=117 I=25 E=1.4764e-07

XFF4834R

XFF4834R_chr38410 lcl|XFF4834R_chr41490895_4436079_f1_XFF4834R-XFF4834R_chr38410

192

407

S=115 I=26 E=3.01784e-07

XFF4834R

XFF4834R_chr32620 lcl|XFF4834R_chr35330226_3757098_r1_XFF4834R-XFF4834R_chr32620

207

410

S=111 I=27 E=9.05307e-07

XFF4834R

XFF4834R_chr41500 lcl|XFF4834R_chr_4826154_4827398_f3_XFF4834R-XFF4834R_chr41500

179

280

S=103 I=34 E=7.02465e-06

XFF4834R

XFF4834R_chr13120 lcl|XFF4834R_chr13870082_1495317_r1_XFF4834R-XFF4834R_chr13120

305

410

S=102 I=28 E=9.44856e-06

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

208

406

S=98 I=26 E=3.17461e-05

XFF4834R

XFF4834R_chr11740 lcl|XFF4834R_chr12240140_1312785_r1_XFF4834R-XFF4834R_chr11740

193

410

S=97 I=26 E=4.08788e-05

X.species

NP_641187.1 lcl|colS-XAC0835

1

411

S=1708 I=87 E=0

two-component system sensor protein

X.species

YP_362619.1 lcl|XCV0888

1

411

S=1705 I=86 E=0

two-component system sensor protein

X.species

NP_636171.1 lcl|colS-XCC0780

1

411

S=1633 I=77 E=0

two-component system sensor protein

X.species

lcl|XALc_2772

1

410

S=1024 I=54 E=6.3567e-117

putative two-component system sensor protein

X.species

lcl|XALc_0662

114

409

S=330 I=32 E=7.83313e-33

putative two-component system sensor protein

X.species

NP_643557.1 lcl|colS-XAC3249

145

408

S=323 I=34 E=5.5222e-32

two-component system sensor protein

X.species

NP_638453.1 lcl|colS-XCC3106

145

409

S=321 I=34 E=1.24239e-31

two-component system sensor protein

X.species

YP_365095.1 lcl|colS-XCV3364

145

409

S=317 I=34 E=2.94524e-31

two-component system sensor protein

X.species

NP_636496.1 lcl|colS-XCC1121

36

410

S=262 I=28 E=1.61845e-24

two-component system sensor protein

X.species

NP_641558.1 lcl|colS-XAC1222

84

411

S=237 I=29 E=1.7769e-21

two-component system sensor protein

pubmed

72

410

S=288 I=31 E=4.38935e-26

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 9425686

 

prodomImg

pubmed

34

410

S=280 I=30 E=4.42409e-25

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15491368

 

prodomImg

pubmed

34

410

S=279 I=30 E=5.04222e-25

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17166231

 

prodomImg

pubmed

83

411

S=241 I=29 E=2.63395e-20

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 15195943

 

prodomImg

pubmed

158

399

S=198 I=27 E=4.02099e-15

Sensor kinase cusS EC=2.7.13.3 ; ATP-binding Cell inner membrane Copper Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compone

Pubmed 11004187

 

prodomImg

sp

158

399

S=198 I=27 E=2.73583e-15

Sensor kinase cusS EC=2.7.13.3 ; ATP-binding Cell inner membrane Copper Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compone

 

prodomImg

sp

158

399

S=193 I=27 E=1.16318e-14

Sensor kinase cusS EC=2.7.13.3 ; ATP-binding Cell inner membrane Copper Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regu

 

prodomImg

sp

158

399

S=183 I=26 E=1.72059e-13

Sensor kinase cusS EC=2.7.13.3 ; ATP-binding Cell inner membrane Copper Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

 

prodomImg

sp

124

410

S=182 I=25 E=2.54725e-13

Sensor protein qseC EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compon

 

prodomImg

sp

111

406

S=181 I=29 E=2.70755e-13

Swarming motility regulation sensor protein rssA EC=2.7.13.3 ; ATP-binding Cell inner membrane Kinase Nucleotide-binding Phosphoprotein Trans

 

prodomImg

Iprscan IPR004358 [PR00344]

354

368

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

372

382

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

386

404

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

410

423

Signal transduction histidine kinase-related protein, C-terminal

Iprscan [G3DSA:1.10.287.240]

203

275

-

Iprscan IPR003594 [G3DSA:3.30.565.10]

283

423

ATPase-like, ATP-binding domain

Iprscan [PTHR23283:SF23]

123

422

-

Iprscan [PTHR23283]

123

422

-

Iprscan IPR003594 [PF02518]

327

421

ATPase-like, ATP-binding domain

Iprscan IPR003661 [PF00512]

215

276

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003661 [SM00388]

213

279

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003594 [SM00387]

322

422

ATPase-like, ATP-binding domain

Iprscan IPR005467 [PS50109]

220

423

Signal transduction histidine kinase, core

Iprscan [seg]

11

31

-

Iprscan [seg]

289

303

-

Iprscan [seg]

367

380

-

Iprscan [seg]

412

423

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [tmhmm]

13

35

-

Iprscan [tmhmm]

128

150

-

PDA043K4

1

216

S=780 I=70 E=5.33335e-87

PD892327

272

330

S=215 I=75 E=1.34963e-18

PD297499

272

411

S=138 I=28 E=3.23137e-09

Iprscan IPR003594 [SSF55874]

277

422

ATPase-like, ATP-binding domain

Iprscan IPR009082 [SSF47384]

203

275

Signal transduction histidine kinase, homodimeric

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9oCttHu7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

111 hits
swiss-prot

Swiss-Prot ncbi-blastp

45 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

16 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

22 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5qDJlx/XFF4834R_chr08410.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5qDJlx/XFF4834R_chr08410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5qDJlx/XFF4834R_chr08410.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5qDJlx/XFF4834R_chr08410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.