Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08050XFF4834R_chr08540746_0931375_f2_XFF4834R-XFF4834R_chr08050XFF4834R_chr08050conserved hypothetical protein

XFF4834R_chr08540746_0931375_f2_XFF4834R-XFF4834R_chr08050 XFF4834R_chr08050
XFF4834R_chr08040
XFF4834R_chr08040
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08060
XFF4834R_chr08060
ID XFF4834R_chr08540746_0931375_f2_XFF4834R-XFF4834R_chr08050
AC XFF4834R_chr08050
LT XFF4834R_chr08050
OR XFF4834R_chr from 930818 to 931375 on strand +
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN 24 codons deleted. Original N terminus was not conserved in XCV or XCC. Could not be longer in XOO.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100716)
MW 21049.7 Da
SQ 185 aa
 
........10........20........30........40........50
| | | | |
MSIVLTPFARARLFPRDGRRNAIQDCRPEQFIQRLNDEAPLRVIEGYAPF
CQLHVHRNWTSTRCLTIPITDDNRHLLRSGYEARSTQELAVLVRWFEGVE
PPVAAYLLPILYSREQLAKEGTPVEADWGVVGCLYTAEPDEIPMAPITML
RNALGVEEGGSGTPLDRDAYRRSVAFWEANANWRP
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KTYGkqwI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKFtwPE/XFF4834R_chr08050.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKFtwPE/XFF4834R_chr08050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKFtwPE/XFF4834R_chr08050.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKFtwPE/XFF4834R_chr08050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.