Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08030XFF4834R_chr08530676_0929960_r2_XFF4834R-XFF4834R_chr08030XFF4834R_chr08030hypothetical protein

XFF4834R_chr08530676_0929960_r2_XFF4834R-XFF4834R_chr08030 XFF4834R_chr08030
XFF4834R_chr08020
XFF4834R_chr08020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08040
XFF4834R_chr08040
ID XFF4834R_chr08530676_0929960_r2_XFF4834R-XFF4834R_chr08030
AC XFF4834R_chr08030
LT XFF4834R_chr08030
OR XFF4834R_chr from 929676 to 929954 on strand -
DE hypothetical protein
IP
CL 10 cryptic genes
EC
GO InterPro


Curated
PM
AN 2 codons deleted to have better RBS.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100723)
MW 9861.5 Da
SQ 92 aa
 
........10........20........30........40........50
| | | | |
MPVVRIVAVPLPAAHSGFRRCDGPLTRGAIPAKHLRHAMVTLALPHKGGE
ACNGDVHAAGSSAKQLTYVTSDGMARCRRRTRCLPTMSLAYR
Iprscan [SignalP-NN(euk)]

1

16

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one J1ppH6XI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1HUHe9/XFF4834R_chr08030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1HUHe9/XFF4834R_chr08030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1HUHe9/XFF4834R_chr08030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1HUHe9/XFF4834R_chr08030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.