Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08020XFF4834R_chr08510970_0929436_r1_XFF4834R-XFF4834R_chr08020XFF4834R_chr08020putative alpha-amylase

XFF4834R_chr08510970_0929436_r1_XFF4834R-XFF4834R_chr08020 XFF4834R_chr08020
XFF4834R_chr08010
XFF4834R_chr08010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08030
XFF4834R_chr08030
ID XFF4834R_chr08510970_0929436_r1_XFF4834R-XFF4834R_chr08020
AC XFF4834R_chr08020
LT XFF4834R_chr08020
OR XFF4834R_chr from 927970 to 929397 on strand -
DE putative alpha-amylase
IP Glycosyl hydrolase, family 13, catalytic domain; Glycoside hydrolase, subgroup, catalytic core; Glycoside hydrolase, catalytic core
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: cation binding (GO:0043169)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 51853.9 Da
SQ 475 aa
 
........10........20........30........40........50
| | | | |
MRNTPAHAPPSLIQRSVRLLLTALVLLVTAANAQADVILHAFNWPYATVE
ARAKQIADAGYRKVLVAPAYRSEGSAWWARYQPQDIRLIDNPLGDTAAFK
KMVQALASNGVETYADIVFNHMANEAATRSDLNYPGSAVLSQYAANPGRY
DSLRLFGTLQSNFLSTSDFGPAQSISNYNDAYQVRNYRICGGGSDPGLPD
LLGNDWVVQQQRAYLQALKNIGVTGFRVDAAKHMTFDHLNRVFDAGIRSG
VYVFGEVITGGGTGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAIGA
SMQQLVDPAASGQALPGNRAVTFAVTHDIPNNAGFRYAILDPVDETLAYA
YLIGRNGGMPMLYTDNNESGDNRWVNAYLRDDLRRMIGFHNGVQGTDMQV
LSSSSCHILFRRGSLGIVGINKCGNPVTTTVGMNNSVLYWNADYVDALGS
GNVVRISSSSYTFTLPARGARMWRR
X.species

NP_641150.1 lcl|amy-XAC0798

1

475

S=2269 I=91 E=0

alpha-amylase

X.species

NP_636139.1 lcl|amy-XCC0748

1

475

S=2097 I=84 E=0

alpha-amylase

X.species

YP_362580.1 lcl|XCV0849

184

475

S=1410 I=91 E=1.54213e-163

putative alpha-amylase (fragment)

X.species

YP_362581.1 lcl|XCV0850

1

151

S=701 I=88 E=1.24838e-77

putative alpha-amylase (fragment)

pubmed

1

475

S=2097 I=84 E=0

Alpha-amylase ; Signal

Pubmed 1527504

 

prodomImg

pubmed

33

468

S=1193 I=50 E=1.24671e-135

Alpha-amylase EC=3.2.1.1 ; Carbohydrate metabolism Glycosidase Hydrolase Secreted Signal

Pubmed 2449422

 

prodomImg

pubmed

38

421

S=250 I=27 E=2.33723e-21

Alpha-amylase ; Glycosidase Hydrolase

Pubmed 12136021

 

prodomImg

pubmed

38

421

S=245 I=27 E=7.71706e-21

Alpha-amylase 2 EC=3.2.1.1 ; Calcium Carbohydrate metabolism Chloride Disulfide bond Glycosidase Hydrolase Metal-binding Signal

Pubmed 11040291

 

prodomImg

pubmed

36

470

S=241 I=27 E=2.75602e-20

Alpha-amylase EC=3.2.1.1 ; Calcium Carbohydrate metabolism Glycosidase Hydrolase Metal-binding Signal

Pubmed 1551601,1756733

 

prodomImg

sp

33

468

S=1193 I=50 E=8.4843e-136

Alpha-amylase EC=3.2.1.1 ; Carbohydrate metabolism Glycosidase Hydrolase Secreted Signal

 

prodomImg

sp

38

421

S=245 I=27 E=5.25172e-21

Alpha-amylase 2 EC=3.2.1.1 ; Calcium Carbohydrate metabolism Chloride Disulfide bond Glycosidase Hydrolase Metal-binding Signal

 

prodomImg

sp

36

470

S=241 I=27 E=1.87556e-20

Alpha-amylase EC=3.2.1.1 ; Calcium Carbohydrate metabolism Glycosidase Hydrolase Metal-binding Signal

 

prodomImg

sp

36

421

S=233 I=25 E=1.68784e-19

Alpha-amylase-related protein EC=3.2.1.1 ; Calcium Carbohydrate metabolism Chloride Disulfide bond Glycosidase Hydrolase Metal-binding Pyrrolidone carboxylic ac

 

prodomImg

sp

38

421

S=232 I=27 E=2.31018e-19

Alpha-amylase 1 EC=3.2.1.1 ; Calcium Carbohydrate metabolism Chloride Disulfide bond Glycosidase Hydrolase Metal-binding Polymorphism Signal

 

prodomImg

Iprscan IPR006046 [PR00110]

77

94

Glycoside hydrolase family 13

Iprscan IPR006046 [PR00110]

110

121

Glycoside hydrolase family 13

Iprscan IPR006046 [PR00110]

223

234

Glycoside hydrolase family 13

Iprscan IPR006046 [PR00110]

252

270

Glycoside hydrolase family 13

Iprscan IPR006046 [PR00110]

318

330

Glycoside hydrolase family 13

Iprscan IPR013781 [G3DSA:3.20.20.80]

34

395

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF26]

38

421

-

Iprscan [PTHR10357]

38

421

-

Iprscan IPR006047 [PF00128]

56

363

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

36

384

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan [seg]

19

31

-

Iprscan [seg]

191

203

-

Iprscan [seg]

259

266

-

Iprscan [SignalP-NN(euk)]

1

35

-

PD404544

204

372

S=621 I=67 E=1.19425e-67

PD858980

374

473

S=284 I=53 E=8.07195e-27

PD434088

128

175

S=167 I=71 E=1.14064e-12

PDA1H448

32

61

S=154 I=97 E=4.28878e-11

PD027217

38

123

S=123 I=30 E=2.55552e-07

PDA6T7R1

34

78

S=105 I=40 E=3.55338e-05

PDA1L228

170

190

S=105 I=90 E=3.74421e-05

Iprscan IPR017853 [SSF51445]

36

394

Glycoside hydrolase, catalytic core

Iprscan [SSF51011]

395

473

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dozXHCAk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

293 hits
swiss-prot

Swiss-Prot ncbi-blastp

60 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA5y4vU/XFF4834R_chr08020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA5y4vU/XFF4834R_chr08020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA5y4vU/XFF4834R_chr08020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBA5y4vU/XFF4834R_chr08020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.