Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr07630kdpFXFF4834R_chr07630 potassium ion accessory transporter subunit

kdpF XFF4834R_chr07630
XFF4834R_chr07620
XFF4834R_chr07620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07640
XFF4834R_chr07640
ID kdpF
AC XFF4834R_chr07630
LT XFF4834R_chr07630
OR XFF4834R_chr from 880569 to 880661 on strand +
DE potassium ion accessory transporter subunit
IP ATPase, P-type, K+-transporting, F subunit
CL 4.3.A.3 The P-type ATPase (P-ATPase) Superfamily GO:0015662
EC
GO InterPro


Curated
PM
AN E.coli: potassium ion accessory transporter subunit. XCV: putative potassium-transporting system small peptide KdpF. Downstream: probable potassium translocating ATPase, subunit A. Upstream of kdpABC. 52 codons deleted to fit to E.coli (see publications).
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120917)
MW 3279.9 Da
SQ 30 aa
 
........10........20........30........40........50
| | | | |
MPGWLSLLCGVAVLVAAAYLLYVVLRPEDF
Show or not Domain decomposition
 
Iprscan IPR011726 [PF09604]

4

30

ATPase, P-type, K+-transporting, F subunit

Iprscan [seg]

11

25

-

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [tmhmm]

4

26

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BmJg9cnX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuCOzex/XFF4834R_chr07630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuCOzex/XFF4834R_chr07630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuCOzex/XFF4834R_chr07630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuCOzex/XFF4834R_chr07630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.