Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr07550XFF4834R_chr_0871030_0871653_r1_XFF4834R-XFF4834R_chr07550XFF4834R_chr07550putative outer membrane protein

XFF4834R_chr_0871030_0871653_r1_XFF4834R-XFF4834R_chr07550 XFF4834R_chr07550
XFF4834R_chr07540
XFF4834R_chr07540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07560
XFF4834R_chr07560
ID XFF4834R_chr_0871030_0871653_r1_XFF4834R-XFF4834R_chr07550
AC XFF4834R_chr07550
LT XFF4834R_chr07550
OR XFF4834R_chr from 871030 to 871653 on strand -
DE putative outer membrane protein
IP
CL 7.4 Outer membrane GO:0009279
EC
GO InterPro


Curated
PM
AN Predicted by PSLpred and CELLO2.5. Confirmed by Phobius.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100715)
MW 22422.7 Da
SQ 207 aa
 
........10........20........30........40........50
| | | | |
MRNTLILAALLATAPFAASAEGLSYTYVEGGWNRTEISVNGDSDDIDGGY
IRGSWQIAQPVYLLASYERANKDYTLGGGFVLEGTLQQATLGIGYRQEMT
ERVEFTADISVLRAKVESDLRLRGRSVDDASDSSNLGFANLGLRGKPSPR
TEAWIKAGYIDGSDVDKGEFVGTLGGQVNFTRTWGLVAEAQFVDNANQYK
VGVRASF
XFF4834R

XFF4834R_chr01940 lcl|XFF4834R_chr_0230084_0230680_r3_XFF4834R-XFF4834R_chr01940

21

207

S=141 I=27 E=7.76177e-11

X.species

NP_641100.1 lcl|XAC0747-XAC0747

1

207

S=970 I=91 E=1.02322e-110

hypothetical protein

X.species

YP_362530.1 lcl|XCV0799

1

207

S=950 I=90 E=2.83313e-108

putative secreted protein

X.species

NP_636086.1 lcl|XCC0694

1

207

S=844 I=83 E=2.04756e-95

hypothetical protein

X.species

YP_361939.1 lcl|XCV0208

21

207

S=136 I=27 E=9.99644e-10

putative secreted protein

X.species

NP_640579.1 lcl|XAC0223-XAC0223

21

207

S=136 I=27 E=9.99644e-10

hypothetical protein

X.species

NP_635600.1 lcl|XCC0205

21

207

S=134 I=27 E=2.13438e-09

hypothetical protein

X.species

lcl|XALc_3077

21

207

S=124 I=26 E=2.94449e-08

hypothetical secreted protein

pubmed

21

207

S=136 I=27 E=3.91341e-08

Putative uncharacterized protein

Pubmed 19107397

 

prodomImg

Iprscan [seg]

5

20

-

Iprscan [SignalP-NN(euk)]

1

19

-

PDA1S9M2

97

207

S=491 I=93 E=5.23317e-52

PD308630

21

97

S=211 I=58 E=4.23562e-18

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QKo1q5hq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKItrhj/XFF4834R_chr07550.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKItrhj/XFF4834R_chr07550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKItrhj/XFF4834R_chr07550.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKItrhj/XFF4834R_chr07550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.