Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr07170lacZ2XFF4834R_chr07170putative beta-galactosidase

lacZ2 XFF4834R_chr07170
XFF4834R_chr07160
XFF4834R_chr07160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07180
XFF4834R_chr07180
ID lacZ2
AC XFF4834R_chr07170
LT XFF4834R_chr07170
OR XFF4834R_chr from 821900 to 824794 on strand +
DE putative beta-galactosidase
IP
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 104666.3 Da
SQ 964 aa
 
........10........20........30........40........50
| | | | |
MRRREFLAGSVGASSLLSVPVLVSGAAAADTTRVGTRAKPRPRPQGSATD
AGGQWLDLDEGWRFHAGDVPFPRLLGQDETYANGKAGRAWGAAAPEFDDT
GWRQLQVPHDFVLEQAVRADANIAQGYRPRGIAWYRRTFRLEEAVRGQAM
ELRLDGVASHATVWVNGMLMARSWSGYNGLAIDITPVARYGNALNCIAIR
VDAEAMDGWWYEGGGIYRHTWLVLRAPLHIAGDGLAAVPREGPGDVWQVP
VQLDLVNSGEQPADAWVEVVLRDTHGAVVAHGETQRRVAAFGTAQAALSI
AVPQPQRWSVDTPVLYRLQAEVRSADGRSDRAACEVGFRSLRFDADHGFF
LNGRALKIKGVCLHQDHAGVGVALPDALHVFRLRRLKSIGCNAIRLHHAV
APELLQACDRLGMLVMAENRLFNPAPDYVALLRNMVRRQRNHPSVFLWSL
LNEEPLQGTATGYAIMARAASAVRALDDTRPITAGMNDGMFATGGAADVV
DVLGFNYRQYNYDRVHAARPRTPMLSSEDTSAFQTRGAWFTDLDAHVVAE
DDSLAADWGNTHRRAWQLIAERPFVAGSFVWTGFDYRGEPTPFEWPSVGS
FFGIMDQCGFAKGAYWLRRALWIDDAPVLHLLPHWNWPGRQGQPIKVMAF
CNAEQVELWLNGRSLGKQAVDRAQSNQWQVDYAPGVLEAVAWRGGHEVAR
TRVETTGAPVALKLTSERSELHGDGRDAQPVTLEAVDAQGRHVPDCNALL
ALQISGGRLLGVGNGDPNSHAADHSTQVALFNGLAQAIVQAGRGAGVLRL
QASSPGLRDAALDIGRTSAPLPASVPIAAPVMVVESWRHTAAFAQPPAPD
LPRRPNDNNSWSNTLPGTLESAPERAGYVLYRSQFTPWQGMQIRGGILDL
GRLSGPAQVFLDGRAVAQAAAGTPIAVALAPAAGERTLAVILQVAADQPF
GFHDVVTVHYRNSP
XFF4834R

XFF4834R_chr31980 lcl|XFF4834R_chr34560105_3674669_f3_XFF4834R-XFF4834R_chr31980

46

814

S=1365 I=41 E=2.20439e-158

XFF4834R

XFF4834R_chr41230 lcl|uidA-XFF4834R_chr41230

77

814

S=924 I=35 E=5.79829e-105

beta-D-glucuronidase

XFF4834R

XFF4834R_chr15580 lcl|XFF4834R_chr16810060_1802750_r2_XFF4834R-XFF4834R_chr15580

233

453

S=111 I=24 E=1.92475e-06

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

134

365

S=104 I=27 E=1.50657e-05

X.species

NP_641061.1 lcl|lacZ-XAC0708

372

964

S=2970 I=95 E=0

truncated beta-galactosidase

X.species

NP_636630.1 lcl|bga-XCC1256

44

825

S=1426 I=42 E=3.45643e-165

beta-galactosidase

X.species

NP_641060.1 lcl|lacZ-XAC0707

1

300

S=1394 I=89 E=2.34731e-161

truncated beta-galactosidase

X.species

NP_641643.1 lcl|bga-XAC1308

46

814

S=1393 I=42 E=3.85835e-161

beta-galactosidase

X.species

YP_363090.1 lcl|XCV1359

46

814

S=1382 I=42 E=6.79457e-160

putative beta-galactosidase precursor

X.species

NP_639455.2 lcl|XCC4116

84

814

S=930 I=34 E=4.38351e-105

beta-galactosidase

X.species

YP_366087.1 lcl|bga2-XCV4356

84

814

S=926 I=35 E=1.55191e-104

beta-galactosidase

X.species

NP_644549.2 lcl|XAC4250-XAC4250

77

814

S=908 I=34 E=2.37508e-102

beta-galactosidase

X.species

NP_643619.2 lcl|XAC3312-XAC3312

87

253

S=112 I=28 E=5.82037e-06

glycosyl hydrolase

X.species

NP_638508.2 lcl|XCC3162

134

253

S=107 I=29 E=2.41074e-05

glycosyl hydrolase

X.species

NP_643384.1 lcl|XAC3075-XAC3075

248

453

S=107 I=25 E=2.58489e-05

beta-mannosidase

X.species

YP_365161.1 lcl|XCV3430

134

253

S=104 I=29 E=4.75881e-05

putative O-glycosyl hydrolase

pubmed

44

825

S=1426 I=42 E=1.51783e-163

Beta-galactosidase Beta-galactosidase Gal02I EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

84

814

S=930 I=34 E=2.17485e-103

Beta-galactosidase Gal02II EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

432

814

S=553 I=34 E=1.07888e-57

Beta-galactosidase ; Cell wall Glycosidase Hydrolase Peptidoglycan-anchor

Pubmed 11004197

 

prodomImg

pubmed

92

418

S=361 I=30 E=1.53975e-34

Beta-galactosidase ; Cell wall Glycosidase Hydrolase Peptidoglycan-anchor

Pubmed 11004197

 

prodomImg

pubmed

92

463

S=519 I=34 E=1.08469e-53

MS140, putative beta-galactosidase ; Glycosidase Hydrolase Plasmid

Pubmed 11722934

 

prodomImg

sp

92

761

S=441 I=24 E=2.57464e-44

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

sp

133

756

S=325 I=23 E=2.87508e-30

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

sp

135

453

S=290 I=27 E=4.54866e-26

Evolved beta-galactosidase subunit alpha EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

sp

135

453

S=268 I=31 E=2.03441e-23

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Magnesium Metal-binding Sodium

 

prodomImg

sp

135

453

S=266 I=30 E=4.38177e-23

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Magnesium Metal-binding Sodium

 

prodomImg

PD675341

223

300

S=392 I=99 E=8.37542e-40

PD340433

634

814

S=360 I=42 E=6.09876e-36

PD676020

828

958

S=345 I=61 E=3.86917e-34

PD840958

504

565

S=257 I=77 E=1.90857e-23

PD736581

566

633

S=218 I=53 E=1.09735e-18

PD675339

1

56

S=139 I=54 E=3.95807e-09

PDA1N8L2

562

668

S=126 I=32 E=1.31722e-07

PD339503

135

222

S=122 I=37 E=4.62291e-07

PD884831

409

503

S=114 I=33 E=3.46416e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one z51dLGfq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

85 hits
swiss-prot

Swiss-Prot ncbi-blastp

75 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkmUY9p/XFF4834R_chr07170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkmUY9p/XFF4834R_chr07170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkmUY9p/XFF4834R_chr07170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkmUY9p/XFF4834R_chr07170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.