Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr07060xcsFXFF4834R_chr07060type II secretion system protein F

xcsF XFF4834R_chr07060
XFF4834R_chr07050
XFF4834R_chr07050
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07070
XFF4834R_chr07070
ID xcsF
AC XFF4834R_chr07060
LT XFF4834R_chr07060
OR XFF4834R_chr from 811878 to 813080 on strand +
DE type II secretion system protein F
IP Bacterial general secretion pathway protein F
CL 4.3.A.5 The Type II (General) Secretory Pathway (IISP) Family GO:0015628 GO:0015447
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: protein secretion by the type II secretion system (GO:0015628)
Cellular Component: membrane (GO:0016020)
Cellular Component: type II protein secretion system complex (GO:0015627)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN nom de gene change (gspF a xcsF) pour etre conforme au nom de gene orthologue chez XCV XCC XAC
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 42984.2 Da
SQ 400 aa
 
........10........20........30........40........50
| | | | |
MPQFDYTVLDLHGRNRHGVISADSINSARAQLEQRQWVPVRVEVAAATAS
TAVRVARFSGKDLVLFTRQLATLVETAPLEEALRTIGTQSERRGVRRVTS
QTHALVVEGFRLSDAMARQGKAFPALYRAMVAAGESAGALPQVLERLADL
LERQAQVRSKLQSALVYPAALAATAGAVVIVLMTFVVPKVVDQFDSMGRA
LPLLTRVVIGVSHFLLHAGIPLLIVLVVALVATVQLLKRPALRLAADRAL
LRAPLLGRLIRDLHAARMARTLAIMVNSGLPLMEGLMIAARTVDNRALRL
ATDTMVNAIREGGSLAAALKRAAVFPPTLLYMASSGENSGRLAPMLERAA
DYLEREFEAFTTAAMSLLEPAIIVLLGGVVAVIVLSILLPILQFNTLALG
XFF4834R

XFF4834R_chr13970 lcl|XFF4834R_chr14830422_1598678_r2_XFF4834R-XFF4834R_chr13970

1

370

S=306 I=26 E=1.76165e-30

XFF4834R

XFF4834R_chr34370 lcl|XFF4834R_chr37330079_3972296_r2_XFF4834R-XFF4834R_chr34370

1

370

S=292 I=28 E=9.97863e-29

XFF4834R

XFF4834R_chr13970 lcl|XFF4834R_chr14830422_1598678_r2_XFF4834R-XFF4834R_chr13970

1

370

S=306 I=26 E=1.76165e-30

XFF4834R

XFF4834R_chr34370 lcl|XFF4834R_chr37330079_3972296_r2_XFF4834R-XFF4834R_chr34370

1

370

S=292 I=28 E=9.97863e-29

X.species

NP_641050.1 lcl|xcsF-XAC0697

1

400

S=1443 I=75 E=1.07952e-167

type II secretion system protein F

X.species

YP_362489.1 lcl|xcsF-XCV0758

1

400

S=1396 I=72 E=5.78378e-162

type II secretion system protein F

X.species

NP_638769.1 lcl|xcsF-XCC3423

1

400

S=1333 I=70 E=2.55367e-154

type II secretion system protein F

X.species

NP_638447.1 lcl|pilC-XCC3100

1

370

S=301 I=26 E=2.91116e-29

fimbrial assembly protein

X.species

YP_365085.1 lcl|pilC-XCV3354

4

370

S=299 I=25 E=5.26682e-29

fimbrial assembly protein

X.species

NP_643550.2 lcl|pilC-XAC3242

1

370

S=287 I=26 E=1.32604e-27

fimbrial assembly protein

X.species

YP_365398.1 lcl|xpsF-XCV3667

1

370

S=287 I=27 E=1.34936e-27

type II secretory pathway component

X.species

lcl|pilC-XALc_0665

3

370

S=287 I=25 E=1.36118e-27

probable fimbrial assembly protein

X.species

lcl|xpsF-XALc_2663

1

356

S=285 I=28 E=2.55002e-27

probable general secretion pathway protein f

X.species

NP_643850.1 lcl|xpsF-XAC3543

58

370

S=279 I=29 E=1.19331e-26

general secretion pathway protein F

X.species

NP_636053.1 lcl|xpsF-XCC0661

1

370

S=278 I=27 E=1.79771e-26

general secretion pathway protein F

pubmed

1

370

S=478 I=34 E=4.32052e-49

Hypothetical type II secretion protein ; Transmembrane Transport

Pubmed 12011463

 

prodomImg

pubmed

1

370

S=477 I=34 E=5.51516e-49

Hypothetical type II secretion protein GspF ; Transmembrane Transport

Pubmed 12011463

 

prodomImg

pubmed

1

370

S=472 I=36 E=1.88562e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

Pubmed 8326859

 

prodomImg

pubmed

59

370

S=472 I=37 E=2.03955e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

Pubmed 1640836

 

prodomImg

pubmed

1

370

S=469 I=34 E=4.58858e-48

GspF, hypothetical type II secretion protein ; Transmembrane Transport

Pubmed 15385503

 

prodomImg

pubmed

1

370

S=469 I=36 E=4.71019e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

Pubmed 1588814

 

prodomImg

pubmed

1

370

S=455 I=35 E=2.10841e-46

XcpS protein ; Transmembrane Transport

Pubmed 8602167

 

prodomImg

pubmed

1

370

S=454 I=31 E=2.93658e-46

Type II protein secretion LspF ; Transmembrane Transport

Pubmed 11254562

 

prodomImg

pubmed

1

370

S=445 I=35 E=3.4029e-45

Type II secretion pathway related protein Type II secretion protein ; Plasmid Transmembrane Transport

Pubmed 9722640,9628576

 

prodomImg

pubmed

1

370

S=445 I=35 E=3.4029e-45

W0024 EtpF protein ; Plasmid Transmembrane Transport

Pubmed 9084155,11401985

 

prodomImg

sp

1

370

S=520 I=34 E=2.31889e-54

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

1

370

S=472 I=36 E=1.29776e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

59

370

S=472 I=37 E=1.4037e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

1

370

S=469 I=36 E=3.24174e-48

General secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

sp

3

370

S=427 I=31 E=4.2671e-43

Putative general secretion pathway protein F ; Cell inner membrane Transmembrane Transport

 

prodomImg

Iprscan IPR003004 [PR00812]

62

74

Bacterial general secretion pathway protein F

Iprscan IPR003004 [PR00812]

160

188

Bacterial general secretion pathway protein F

Iprscan IPR003004 [PR00812]

363

377

Bacterial general secretion pathway protein F

Iprscan IPR003004 [PR00812]

379

398

Bacterial general secretion pathway protein F

Iprscan IPR018076 [PF00482]

66

188

Type II secretion system F domain

Iprscan IPR018076 [PF00482]

269

390

Type II secretion system F domain

Iprscan IPR011850 [TIGR02120]

4

398

General secretion pathway protein F

Iprscan IPR001992 [PS00874]

160

188

Type II secretion system conserved site

Iprscan [seg]

40

57

-

Iprscan [seg]

164

182

-

Iprscan [seg]

222

259

-

Iprscan [seg]

371

392

-

Iprscan [tmhmm]

165

187

-

Iprscan [tmhmm]

207

229

-

Iprscan [tmhmm]

372

394

-

PD550204

272

370

S=124 I=30 E=1.42133e-07

PD550204

62

154

S=121 I=29 E=3.87385e-07

PDA5K2D6

86

209

S=123 I=23 E=2.01444e-07

PDA1O156

345

370

S=121 I=92 E=3.67641e-07

PDA1X696

139

163

S=118 I=100 E=8.2712e-07

PD001695

82

146

S=108 I=40 E=1.34664e-05

PDA4S381

275

346

S=108 I=36 E=1.44392e-05

PD811857

288

342

S=102 I=45 E=5.92865e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YqCbp1MC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

58 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE4WVeZ/XFF4834R_chr07060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE4WVeZ/XFF4834R_chr07060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE4WVeZ/XFF4834R_chr07060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE4WVeZ/XFF4834R_chr07060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.