Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06710mltBXFF4834R_chr06710probable membrane-bound lytic murein transglycosylase

mltB XFF4834R_chr06710
XFF4834R_chr06700
XFF4834R_chr06700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06720
XFF4834R_chr06720
ID mltB
AC XFF4834R_chr06710
LT XFF4834R_chr06710
OR XFF4834R_chr from 768910 to 770049 on strand +
DE probable membrane-bound lytic murein transglycosylase
IP Lytic murein transglycosylase B
CL 7.4 Outer membrane GO:0009279
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100819)
MW 40956.2 Da
SQ 379 aa
 
........10........20........30........40........50
| | | | |
MIRRTLTCLLTLGLVACATQPSPPSPPPAASAPPAKPPVAPAAPASAAAE
APALPPVDLTPVPFEIARANFVRDTAAKYGIDAAQIEAVLAQAQFKDAIV
TAMSRPAERVKPWNEYRPMFITQARIDGGRNFLAQHRAELSKVEAATGVP
AQVIVAIIGVETSYGTNAGKYRVLDALYTLAFRYPRSGDPAKLEREVRRE
LFFRDELGQLFALGKEEQLDVTRLIGSYAGAMGMGQFMPSSYRQFGVDGD
ADGKRNLFTDYNDVFASIANYFVKKGGWVRGGQVAVPATLAADHEEFNPT
DWSPVYTLADLSARGYRPNAPVVAGSTATPISLDDANGKQYWLGFQNFYA
ITRYNISKMYAMAVFQLSEAIAGKELPPA
XFF4834R

XFF4834R_plc00360 lcl|XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360

64

374

S=274 I=30 E=1.27648e-26

XFF4834R

XFF4834R_chr41640 lcl|XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640

76

373

S=267 I=31 E=9.81876e-26

conserved protein

X.species

NP_641015.1 lcl|mltB-XAC0662

57

379

S=1564 I=92 E=0

membrane-bound lytic transglycosylase

X.species

YP_362454.1 lcl|mltB-XCV0723

57

379

S=1557 I=92 E=0

membrane-bound lytic transglycosylase

X.species

NP_638804.1 lcl|mltB-XCC3458

57

379

S=1544 I=92 E=5.93648e-180

membrane-bound lytic transglycosylase

X.species

lcl|mltB-XALc_0812

57

379

S=1321 I=76 E=7.28091e-153

probable membrane-bound lytic murein transglycosylase protein

X.species

lcl|XALc_3122

72

374

S=308 I=35 E=3.79338e-30

putative membrane bound lytic murein transglycosylase b transmembrane protein

X.species

NP_644590.2 lcl|XAC4296-XAC4296

64

373

S=284 I=31 E=3.1784e-27

epimerase

X.species

YP_366126.1 lcl|XCV4395

64

373

S=275 I=31 E=3.28846e-26

putative transglycosylase precursor

X.species

lcl|XALc_1923

61

373

S=275 I=32 E=3.98378e-26

probable lytic murein transglycosylase precursor transmembrane protein

X.species

NP_643533.1 lcl|mltB-XAC3225

64

374

S=273 I=30 E=6.16056e-26

transglycosylase

X.species

NP_644735.1 lcl|mlt-XACb0007

64

374

S=273 I=30 E=6.66345e-26

lytic murein transglycosylase

X.species

YP_364171.1 lcl|hpaJ-XCV2440

64

374

S=273 I=30 E=6.96036e-26

lytic murein transglycosylase precursor

X.species

NP_639491.1 lcl|XCC4157

224

373

S=199 I=35 E=5.22636e-17

epimerase

X.species

NP_639491.1 lcl|XCC4157

64

181

S=130 I=31 E=1.33119e-08

epimerase

pubmed

71

372

S=513 I=40 E=2.55249e-53

Membrane-bound lytic murein transglycosylase B EC=4.2.2.n1 ; Cell outer wall biogenesis/degradation Lipoprotein Lyase Palmitate Signal

Pubmed 7476170,7789526

 

prodomImg

pubmed

72

371

S=454 I=35 E=3.07418e-46

Predicted membrane-bound lytic transglycosylase

Pubmed 10988064

 

prodomImg

pubmed

72

369

S=418 I=33 E=8.06456e-42

Predicted membrane-bound lytic transglycosylase

Pubmed 16008504

 

prodomImg

pubmed

64

373

S=316 I=31 E=1.79628e-29

Translycolase-related protein

Pubmed 18773201

 

prodomImg

pubmed

64

374

S=273 I=30 E=2.94029e-24

Putative murein transglycosylase ; Signal

Pubmed 14645268

 

prodomImg

sp

71

372

S=513 I=40 E=1.7365e-53

Membrane-bound lytic murein transglycosylase B EC=4.2.2.n1 ; Cell outer wall biogenesis/degradation Lipoprotein Lyase Palmitate Signal

 

prodomImg

Iprscan [G3DSA:1.10.530.10]

108

377

-

Iprscan IPR011757 [TIGR02282]

69

371

Lytic murein transglycosylase B

Iprscan [PS51257]

1

17

-

Iprscan [seg]

5

56

-

Iprscan [seg]

193

207

-

Iprscan [SignalP-NN(euk)]

1

17

-

PD135920

72

189

S=256 I=48 E=1.91943e-23

PDA1L509

286

317

S=157 I=91 E=1.75688e-11

PD903053

182

226

S=137 I=64 E=4.8645e-09

PD379248

336

379

S=108 I=55 E=1.52049e-05

Iprscan [SSF53955]

47

375

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QelwmYoP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYYxeLu/XFF4834R_chr06710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYYxeLu/XFF4834R_chr06710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYYxeLu/XFF4834R_chr06710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYYxeLu/XFF4834R_chr06710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.