Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06620XFF4834R_chr06890788_0757172_f3_XFF4834R-XFF4834R_chr06620XFF4834R_chr06620putative TonB-dependent transporter

XFF4834R_chr06890788_0757172_f3_XFF4834R-XFF4834R_chr06620 XFF4834R_chr06620
XFF4834R_chr06610
XFF4834R_chr06610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06630
XFF4834R_chr06630
ID XFF4834R_chr06890788_0757172_f3_XFF4834R-XFF4834R_chr06620
AC XFF4834R_chr06620
LT XFF4834R_chr06620
OR XFF4834R_chr from 754788 to 757172 on strand +
DE putative TonB-dependent transporter
IP TonB-dependent receptor, beta-barrel; TonB-dependent receptor, plug
CL 4.1.B.14 The Outer Membrane Receptor (OMR) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: receptor activity (GO:0004872)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20120323)
MW 85474.3 Da
SQ 794 aa
 
........10........20........30........40........50
| | | | |
MAAGRCRTATLHRKGLAGACAMVLLARSALAVAAEAPQVTWLDRIEVTAT
PIPGTTIDAAQLPYMVQSASNAELSRGRSNNLSDLLQRRFVGVDGKDVQG
SAFQNDLTFHGFRASALPGASQGVSVYLDGVRFNEPFADIVSWDMLPEAA
ITAVTLMPGSNPLFGPNTLGGAVVLSTASGLTAPGLQGEVSIGSGARKRL
DAGYGVASANGWHGFVALTGFDENGWRDASEGRLGTVFGKVGKQGERTDW
SLSLLHGRSRLIGNGLLPDTRYTDEGPEPGLYRADRRSVYTSPDLTRNRN
TLLTAQLDHRFDEDTALHALAYSRVGRRDTVNGDIGEDYEAFVEECASGY
AADGSALDADCDVARADADALPTGALNTTQMRQEAQGVALNLSTQWSAHA
LTTGVTFDRGHVRYRQFARDGWVQLDRSIAADPDAERAFFSGVRGSTETL
GVFLADTWALSNATHLTAAVRWNRVVVDNILSTADDGDRPRERFVYAKAN
PSLGLTHRLDSGLTLYGSVAQNSRAPTAIELGCADPTQPCRLPTGLQADP
RLEQIISRTYELGARWTPSADSTATLSVYRADNRDDILFLRAPDTQLGYF
DNVGRTRYQGADLALRLRSGDWHWSAGYSFLDATYRSDGELLSGERVIAL
RPGLRIAALPRHNLKLGVEWQRDALTLGAGVRAVSGRVASGNEDGHVDNA
EAGEPAPERIDIGSAGYALVDLQARWTITARVSLFARIDNVFDRHYATYA
AVAEDVFPDGELARPQDGPVETGPARFLAPGVPRQYLIGVRWAL
XFF4834R

XFF4834R_chr01280 lcl|XFF4834R_chr01380707_0159845_r2_XFF4834R-XFF4834R_chr01280

496

794

S=213 I=31 E=8.00846e-19

predicted iron outer membrane transporter

XFF4834R

XFF4834R_chr08580 lcl|XFF4834R_chr09150648_0996975_f1_XFF4834R-XFF4834R_chr08580

71

267

S=113 I=27 E=9.68917e-07

XFF4834R

XFF4834R_chr06990 lcl|XFF4834R_chr07300773_0801818_r2_XFF4834R-XFF4834R_chr06990

561

747

S=109 I=29 E=3.08953e-06

XFF4834R

XFF4834R_chr01280 lcl|XFF4834R_chr01380707_0159845_r2_XFF4834R-XFF4834R_chr01280

496

794

S=213 I=31 E=8.00846e-19

predicted iron outer membrane transporter

XFF4834R

XFF4834R_chr08580 lcl|XFF4834R_chr09150648_0996975_f1_XFF4834R-XFF4834R_chr08580

71

267

S=113 I=27 E=9.68917e-07

XFF4834R

XFF4834R_chr06990 lcl|XFF4834R_chr07300773_0801818_r2_XFF4834R-XFF4834R_chr06990

561

747

S=109 I=29 E=3.08953e-06

X.species

NP_641006.1 lcl|fepA-XAC0653

1

794

S=3717 I=90 E=0

TonB-dependent receptor

X.species

YP_362445.1 lcl|XCV0714

1

794

S=3657 I=88 E=0

TonB-dependent outer membrane receptor

X.species

NP_638820.1 lcl|fepA-XCC3474

1

794

S=3588 I=86 E=0

TonB-dependent receptor

X.species

NP_640482.2 lcl|yncD-XAC0126

496

792

S=216 I=32 E=1.34689e-18

iron transporter

X.species

YP_361833.1 lcl|XCV0102

496

792

S=212 I=32 E=3.76825e-18

TonB-dependent outer membrane receptor

X.species

NP_635493.1 lcl|yncD-XCC0098

496

792

S=186 I=32 E=5.14477e-15

iron transporter

X.species

NP_637411.1 lcl|fecA-XCC2046

501

747

S=143 I=27 E=8.20397e-10

TonB-dependent receptor

X.species

NP_641204.1 lcl|XAC0852-XAC0852

71

267

S=110 I=26 E=8.69118e-06

TonB-dependent receptor

X.species

lcl|XALc_2726

44

232

S=102 I=28 E=7.55322e-05

putative tonb-dependent outer membrane receptor protein

X.species

lcl|XALc_3025

449

620

S=101 I=26 E=9.72614e-05

putative tonb-dependent outer membrane receptor protein

pubmed

433

749

S=419 I=31 E=1.24254e-41

Outer membrane receptor-like protein

Pubmed 10482517

 

prodomImg

pubmed

449

754

S=155 I=26 E=1.04312e-09

Putative uncharacterized protein ; Plasmid

Pubmed 18812424

 

prodomImg

pubmed

500

670

S=151 I=29 E=3.18424e-09

IrgA-like protein

Pubmed 11574920

 

prodomImg

pubmed

500

670

S=151 I=29 E=3.21213e-09

Putative siderophore receptor IreA

Pubmed 11553562

 

prodomImg

pubmed

500

670

S=151 I=29 E=3.66092e-09

Iron-regulated outer membrane protein

Pubmed 16369033

 

prodomImg

pubmed

449

685

S=119 I=26 E=2.59696e-05

Putative uncharacterized protein ; Plasmid

Pubmed 11959547

 

prodomImg

sp

453

638

S=133 I=31 E=3.56675e-07

Probable tonB-dependent receptor yncD ; Cell membrane outer Signal box

 

prodomImg

PDA1T6Y9

298

446

S=550 I=72 E=6.25596e-59

PD696706

626

713

S=226 I=52 E=1.03069e-19

PD709804

751

794

S=223 I=98 E=2.71287e-19

PDA1W883

1

60

S=218 I=73 E=1.01202e-18

PD608743

139

230

S=205 I=45 E=3.87213e-17

PDA1I4L4

228

297

S=190 I=59 E=2.75138e-15

PDA374A5

714

750

S=182 I=95 E=2.4545e-14

PDA9T5Z3

488

554

S=128 I=39 E=7.99378e-08

PDA1N693

715

794

S=123 I=34 E=3.64421e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YCPhd9GI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6SV_Sb/XFF4834R_chr06620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6SV_Sb/XFF4834R_chr06620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6SV_Sb/XFF4834R_chr06620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6SV_Sb/XFF4834R_chr06620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.