Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06240XFF4834R_chr06470546_0709970_r2_XFF4834R-XFF4834R_chr06240XFF4834R_chr06240putative endoglucanase EngXCA

XFF4834R_chr06470546_0709970_r2_XFF4834R-XFF4834R_chr06240 XFF4834R_chr06240
XFF4834R_chr06230
XFF4834R_chr06230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06250
XFF4834R_chr06250
ID XFF4834R_chr06470546_0709970_r2_XFF4834R-XFF4834R_chr06240
AC XFF4834R_chr06240
LT XFF4834R_chr06240
OR XFF4834R_chr from 708546 to 709970 on strand -
DE putative endoglucanase EngXCA
IP Glycoside hydrolase, family 5; Carbohydrate-binding; Cellulose-binding family II/chitobiase, carbohydrate-binding domain; Glycoside hydrolase, catalytic core
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: cation binding (GO:0043169)
Molecular Function: polysaccharide binding (GO:0030247)
Molecular Function: carbohydrate binding (GO:0030246)
Molecular Function: catalytic activity (GO:0003824)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20111028)
MW 51345.2 Da
SQ 474 aa
 
........10........20........30........40........50
| | | | |
MSIFRAASTLALATMLALTAAPAFSYSVSNNKIVDDNGNVVQLKGVNVFG
FETGNHVMHGLWARNWKEMINQMQGLGFNAVRLPFCPATLRSGQMPSSID
YSRNADLQGLTSLQILDKVINEFNARGMYVLLDHHTPDCAAISELWYTSS
YSEAQWLDDLRFVANRYKNVPSVIGVDLKNEPHGAATWGTGNAATDWNTA
AERGSAAVLAVAPKWIIAVEGITDNPVCSTNGGIFWGGNLQPLACTPLNI
PANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWDRHFGQFAGSYALLL
GEFGGKYGQGDARDKVWQDALVKYLRSKGINEGFYWSWNPNSGDTGGILR
DDWISVREDKMTLLRTLWGTVSNTTPTPTPTPTPTPTPTPSSGFTTKVTP
DSTWNGGYCNRVQVTNTGTASGNWSISLTVAGTVNNAWNVTWSQSGTTLQ
ASGVDFNRTLAPGATAEFGFCAAG
X.species

NP_640965.1 lcl|engXCA-XAC0612

1

474

S=2201 I=88 E=0

cellulase

X.species

YP_362401.1 lcl|engXCA-XCV0670

1

474

S=2169 I=87 E=0

extracellular endoglucanase precursor

X.species

NP_638867.1 lcl|engXCA-XCC3521

1

473

S=1979 I=78 E=0

cellulase

X.species

lcl|XALc_2967

26

473

S=1387 I=57 E=7.90971e-161

putative extracellular endoglucanase precursor protein

X.species

lcl|XALc_2969

24

370

S=1311 I=68 E=1.59076e-151

hypothetical extracellular endoglucanase precursor (cellulase) protein

X.species

lcl|XALc_2969

394

472

S=265 I=61 E=6.93847e-25

hypothetical extracellular endoglucanase precursor (cellulase) protein

X.species

NP_638881.1 lcl|XCC3535

33

371

S=497 I=35 E=5.42047e-53

cellulase

X.species

lcl|XALc_0874

394

473

S=272 I=60 E=1.25634e-25

conserved hypothetical protein.

X.species

lcl|XALc_0865

394

472

S=126 I=38 E=4.78467e-08

hypothetical extracellular endoglucanase precursor (cellulase) protein

X.species

lcl|XALc_0484

394

472

S=126 I=37 E=5.64671e-08

putative 1,4-beta-cellobiosidase (exoglucanase) protein

pubmed

1

473

S=1979 I=78 E=0

Major extracellular endoglucanase EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Glycosidase Hydrolase Polysaccharide Repeat Signa

Pubmed 2373365

 

prodomImg

pubmed

165

353

S=887 I=87 E=1.39816e-98

Cellulase

Pubmed 17249420

 

prodomImg

pubmed

26

364

S=755 I=44 E=1.49222e-82

Endoglucanase EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Glycosidase Hydrolase Polysaccharide

Pubmed 2307659

 

prodomImg

pubmed

26

360

S=734 I=46 E=5.50914e-80

Endoglucanase E1 EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Disulfide bond Glycosidase Hydrolase Polysaccharide Signal

Pubmed 8718854

 

prodomImg

pubmed

401

473

S=118 I=36 E=2.12647e-05

Endoglucanase E1 EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Disulfide bond Glycosidase Hydrolase Polysaccharide Signal

Pubmed 8718854

 

prodomImg

sp

1

473

S=1979 I=78 E=0

Major extracellular endoglucanase EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Glycosidase Hydrolase Polysaccharide Repeat Signa

 

prodomImg

sp

26

364

S=755 I=44 E=1.01552e-82

Endoglucanase EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Glycosidase Hydrolase Polysaccharide

 

prodomImg

sp

26

360

S=734 I=46 E=3.74921e-80

Endoglucanase E1 EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Disulfide bond Glycosidase Hydrolase Polysaccharide Signal

 

prodomImg

sp

401

473

S=118 I=36 E=1.44716e-05

Endoglucanase E1 EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Disulfide bond Glycosidase Hydrolase Polysaccharide Signal

 

prodomImg

sp

28

368

S=421 I=32 E=3.02442e-42

Endoglucanase D EC=3.2.1.4 ; Carbohydrate metabolism Cellulose degradation Glycosidase Hydrolase Polysaccharide Repeat Signal

 

prodomImg

Iprscan IPR013781 [G3DSA:3.20.20.80]

21

375

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR012291 [G3DSA:2.60.40.290]

388

473

Cellulose-binding family II/chitobiase, carbohydrate-binding domain

Iprscan IPR001547 [PF00150]

32

346

Glycoside hydrolase, family 5

Iprscan IPR001919 [PF00553]

397

472

Cellulose-binding domain, family II, bacterial type

Iprscan IPR001919 [SM00637]

394

474

Cellulose-binding domain, family II, bacterial type

Iprscan IPR018087 [PS00659]

174

183

Glycoside hydrolase, family 5, conserved site

Iprscan IPR001919 [PS51173]

387

474

Cellulose-binding domain, family II, bacterial type

Iprscan [seg]

6

23

-

Iprscan [seg]

184

195

-

Iprscan [seg]

374

390

-

Iprscan [SignalP-NN(euk)]

1

25

-

PD302860

33

272

S=572 I=48 E=9.78384e-62

PD296509

264

370

S=283 I=56 E=1.09245e-26

PDA3F5N6

401

472

S=179 I=42 E=3.79581e-14

PD908329

222

263

S=162 I=62 E=4.47222e-12

PD292259

391

433

S=157 I=72 E=1.62527e-11

PDA9B479

33

72

S=147 I=68 E=3.26199e-10

PD001333

404

470

S=115 I=47 E=2.50286e-06

Iprscan IPR017853 [SSF51445]

21

375

Glycoside hydrolase, catalytic core

Iprscan IPR008965 [SSF49384]

388

474

Carbohydrate-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QRVmjarb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

62 hits
swiss-prot

Swiss-Prot ncbi-blastp

15 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQJctwk/XFF4834R_chr06240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQJctwk/XFF4834R_chr06240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQJctwk/XFF4834R_chr06240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQJctwk/XFF4834R_chr06240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.