Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06180XFF4834R_chr06350622_0697656_f1_XFF4834R-XFF4834R_chr06180XFF4834R_chr06180conserved hypothetical protein

XFF4834R_chr06350622_0697656_f1_XFF4834R-XFF4834R_chr06180 XFF4834R_chr06180
XFF4834R_chr06170
XFF4834R_chr06170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0673
XFF4834R_chr_0673
ID XFF4834R_chr06350622_0697656_f1_XFF4834R-XFF4834R_chr06180
AC XFF4834R_chr06180
LT XFF4834R_chr06180
OR XFF4834R_chr from 696664 to 697656 on strand +
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN 14 codons deleted to fit to other xanthomonads. First 14 codons were not conserved in Xanthomonas oryzae pv. oryzae KACC10331 the sequence of which is also longer than at the other xanthomonads.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100706)
MW 36022.8 Da
SQ 330 aa
 
........10........20........30........40........50
| | | | |
VITRRKEALVPHVAAVACTGAILFFLACLLLYMPPPGQTLQHDDTLQVYF
VPRPQLTPPTPQQPPQAPERKPRVASAARAAPLATRTPPPPRQLAAATAP
ASDSMSAQLYTRDGRLRMAQVDPMAQTGSAVPPGMTDERAQAKARKIMER
VNPVQYQETRFAKDWKSDGTLGDVAVQEMNRGMKKFNDMLNGPQTQVAKA
RPPPDVRFNPALAGNQAEMGSEATGDAYKSAPIAHETLPDLKGEASRRIR
EALAALEQRSARCDASRRTSLLSPVRTHLSDLERAEHALNNGADPVMAAQ
MLPRQADSAYDLARRALWYADRQLKQCALG
X.species

YP_362395.1 lcl|XCV0664

1

330

S=1432 I=84 E=2.23914e-166

hypothetical protein

X.species

NP_640960.1 lcl|XAC0607-XAC0607

1

330

S=1421 I=85 E=4.19128e-165

hypothetical protein

X.species

NP_638872.1 lcl|XCC3526

104

330

S=1012 I=84 E=1.55412e-115

hypothetical protein

X.species

NP_638872.1 lcl|XCC3526

2

51

S=230 I=76 E=9.61281e-21

hypothetical protein

Iprscan [seg]

52

68

-

Iprscan [seg]

75

102

-

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [tmhmm]

13

35

-

PD607462

1

330

S=1259 I=73 E=4.57225e-145

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BXKqIgEU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeEA9rj/XFF4834R_chr06180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeEA9rj/XFF4834R_chr06180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeEA9rj/XFF4834R_chr06180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeEA9rj/XFF4834R_chr06180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.