Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr05820TXcd1_2XFF4834R_chr05820Xcd1 transposase peptide 2

TXcd1_2 XFF4834R_chr05820
XFF4834R_chr05800
XFF4834R_chr05800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05830
XFF4834R_chr05830
ID TXcd1_2
AC XFF4834R_chr05820
LT XFF4834R_chr05820
OR XFF4834R_chr from 657539 to 658366 on strand -
DE Xcd1 transposase peptide 2
IP Integrase, catalytic core
CL 8.3.1 transposases GO:0004803
EC
GO InterPro
Biological Process: DNA integration (GO:0015074)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN ISXcd1 contains 2 transposase ORF (peptide 1 and peptide 2 with 88 and 275 aa, respectively). ISXcd1 belongs to IS3 family and IS407 group. ISXcd1 (Lee and Lin, 2000) described in ISfinder database is a fused transposase (frameshift at position 334-337) in X. axonopodis pv. dieffenbachiae. There are 6 copies of ISXcd1 in CFBP4834-R genome including one copy on plasmide 3. Furthermore a fragment of ISXcd1 is present on plasmide 1.
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by darrasse (20111108)
MW 32213.7 Da
SQ 275 aa
 
........10........20........30........40........50
| | | | |
MVRPSQRREMARWAVDGGHTNIRHACRTFAVSETCFRYQAKASEENARIA
DWLVRLTTTYRDWGFGLCFLHLRNVKGFGWNHKRVYRIYRELELNLRIKP
KKRLVRERPEPLAVPETINQVWSMDFMHDQLADGRSFRLFNVLDDFNREG
LGIEVDLSLPSARVIRSLEQIIDWRGKPNAIRCDNGPEYISGALLAWAQQ
RGIRIEHIQPGKPQQNAYVERYNRTVRYAWLATTLFDTIEQVQDKATRWL
WTYNHERPNMALGGITPAMKLAMAA
XFF4834R

XFF4834R_plc00330 lcl|XFF4834R_plc00270546_0028373_r3_XFF4834R-XFF4834R_plc00330

1

275

S=1477 I=100 E=1.43979e-172

XFF4834R

XFF4834R_chr25040 lcl|XFF4834R_chr27450409_2898236_r2_XFF4834R-XFF4834R_chr25040

1

275

S=1477 I=100 E=1.43979e-172

XFF4834R

XFF4834R_chr15780 lcl|XFF4834R_chr17000220_1824047_r2_XFF4834R-XFF4834R_chr15780

1

275

S=1477 I=100 E=1.43979e-172

XFF4834R

XFF4834R_chr15560 lcl|XFF4834R_chr16760930_1796757_f1_XFF4834R-XFF4834R_chr15560

1

275

S=1477 I=100 E=1.43979e-172

XFF4834R

XFF4834R_chr14990 lcl|XFF4834R_chr16060003_1719830_r2_XFF4834R-XFF4834R_chr14990

1

275

S=1477 I=100 E=1.43979e-172

XFF4834R

XFF4834R_plc_0029 lcl|XFF4834R_plc00230315_0023929_f2_XFF4834R-XFF4834R_plc_0029

80

275

S=959 I=92 E=7.61647e-110

XFF4834R

XFF4834R_plc_0044 lcl|XFF4834R_plc00380239_0037793_r3_XFF4834R-XFF4834R_plc_0044

92

275

S=934 I=93 E=1.00423e-106

XFF4834R

XFF4834R_chr_2531 lcl|XFF4834R_chr26000544_2749137_r1_XFF4834R-XFF4834R_chr_2531

88

268

S=439 I=46 E=7.6142e-47

XFF4834R

XFF4834R_chr_2090 lcl|XFF4834R_chr_2252697_2253278_r2_XFF4834R-XFF4834R_chr_2090

92

268

S=419 I=47 E=2.28033e-44

XFF4834R

XFF4834R_plc_0045 lcl|XFF4834R_plc00380860_0038066_r3_XFF4834R-XFF4834R_plc_0045

1

68

S=318 I=85 E=4.34144e-32

X.species

NP_642739.1 lcl|XAC2424-XAC2424

1

275

S=1402 I=94 E=6.57854e-163

ISxcd1 transposase

X.species

NP_641839.1 lcl|XAC1505-XAC1505

1

275

S=1402 I=94 E=6.57854e-163

ISxcd1 transposase

X.species

YP_365143.1 lcl|XCV3412

1

275

S=1375 I=92 E=1.26191e-159

ISxac2 transposase

X.species

YP_362352.1 lcl|XCV0621

1

275

S=1375 I=92 E=1.26191e-159

ISxac2 transposase

X.species

YP_363027.1 lcl|XCV1296

1

275

S=1368 I=91 E=8.81901e-159

ISxac2 transposase

X.species

NP_644741.1 lcl|XACb0013-XACb0013

1

275

S=1366 I=91 E=1.42455e-158

ISxac2 transposase

X.species

NP_644691.1 lcl|XACa0005-XACa0005

1

275

S=1366 I=91 E=1.42455e-158

ISxac2 transposase

X.species

NP_644244.1 lcl|XAC3943-XAC3943

1

275

S=1366 I=91 E=1.42455e-158

ISxac2 transposase

X.species

NP_644072.1 lcl|XAC3765-XAC3765

1

275

S=1366 I=91 E=1.42455e-158

ISxac2 transposase

X.species

NP_643592.1 lcl|XAC3284-XAC3284

1

275

S=1366 I=91 E=1.42455e-158

ISxac2 transposase

pubmed

1

275

S=1370 I=92 E=1.8982e-157

Transposase ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

2

269

S=940 I=64 E=2.32009e-105

Transposase

Pubmed 9375791,10561613

 

prodomImg

pubmed

2

268

S=657 I=48 E=4.37469e-71

Transposase OrfB

Pubmed 9435062

 

prodomImg

pubmed

2

267

S=641 I=47 E=3.57382e-69

IS1400 transposase B

Pubmed 7607411,8955291

 

prodomImg

pubmed

23

268

S=470 I=39 E=2.04528e-48

Insertion sequence IS407 OrfB

Pubmed 19025565

 

prodomImg

pubmed

1

268

S=448 I=37 E=8.98946e-46

Putative uncharacterized protein

Pubmed 10398747

 

prodomImg

pubmed

1

268

S=447 I=37 E=1.17792e-45

Putative uncharacterized protein

Pubmed 9130589,10398747

 

prodomImg

pubmed

23

268

S=433 I=39 E=6.67217e-44

IS407A, transposase OrfB TnpB

Pubmed 11373120

 

prodomImg

pubmed

23

268

S=431 I=39 E=1.04083e-43

Insertion element IS407 uncharacterized 31.7 kDa protein ; Transposable

Pubmed 1718819

 

prodomImg

pubmed

4

268

S=420 I=38 E=2.44396e-42

Transposase

Pubmed 9973349

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

117

254

-

Iprscan IPR001584 [PF00665]

114

270

Integrase, catalytic core

Iprscan IPR001584 [PS50994]

105

275

Integrase, catalytic core

PD842167

164

208

S=173 I=69 E=1.57838e-13

PDA1H0K5

29

66

S=161 I=74 E=4.68988e-12

PD611211

231

266

S=157 I=75 E=1.46958e-11

PDA3V2E2

1

28

S=149 I=100 E=1.24419e-10

PDA9M7K7

119

267

S=126 I=28 E=8.31038e-08

PDA34261

130

206

S=118 I=40 E=7.54408e-07

PDA1O0Z3

1

28

S=116 I=79 E=1.50224e-06

PD432551

131

162

S=116 I=72 E=1.55556e-06

PDA2W2Z1

143

178

S=106 I=56 E=2.42457e-05

PD893233

23

153

S=105 I=29 E=2.76333e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jagEncOk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

122 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

12 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByTjaLZ/XFF4834R_chr05820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByTjaLZ/XFF4834R_chr05820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByTjaLZ/XFF4834R_chr05820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByTjaLZ/XFF4834R_chr05820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.