Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr05370xopXXFF4834R_chr05370Xanthomonas outer protein X, type III effector XopX

xopX XFF4834R_chr05370
XFF4834R_chr05360
XFF4834R_chr05360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05380
XFF4834R_chr05380
ID xopX
AC XFF4834R_chr05370
LT XFF4834R_chr05370
OR XFF4834R_chr from 604478 to 606607 on strand -
DE Xanthomonas outer protein X, type III effector XopX
IP
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro


Curated
PM
AN Type III effector XopX.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20110209)
MW 75135 Da
SQ 709 aa
 
........10........20........30........40........50
| | | | |
MEIKKQQTAGPSSLAPLHDTHTDNAPVADATPPTQTPLHPSLSALTPRSR
SRASTADSEHSASPVPPHDAEPPAHSPEGAAGPSTTTTLAARANAALASG
VQQAYAAVSKGASNLWSLADLRTMLQIHADDPAFLQMVRHTDPEQLAPHS
LAACRQQITQLRDVIEAATGLEARFRQQLLGDIKAVEDALQPLEHGTPAA
GRALKSLANLVNLWPLIVPSPFLGNQAKTFAYSIAAATKGVMTLSASALR
PTADGLPFPLMGGQLGRDANEMHFYAILLNGLFLTTELPKKFGNPSMRHQ
AEAVENNLGFAAAASTACAAMVLTPFLWNSLNVLGNRLQHTVSHVGAGIA
ESYGFQSQAQRLRARLTPGQISAQLRTQLNEICAALENGREAFQQARRAF
TDPSQGHELTRTLNAQCTHLLETLDQCSKRLSTALQVDQNQNQAQPATIP
RQVTNHDIAPKLALALLGAGVTGLTVYLIQPDRIGTVDLVADSILVTTVM
MQSALNAHATRQDAMERFKAMCSSSLVMALALGVEKLSKTLADKSLIESS
SASPYYAGAIMSLMAMTMPGPMARGAELAMNWGGAQVMRVFKGPDGTTLA
TRMPSSPEELIQNLEDTARYVQSLSPDDAQEYAQRVGEIALQVIEDAGAQ
AQARPSSSVTITEIEDIADIEETNDAAALAAASASPEQRSPAHAHRSPDQ
VATSTAPSS
X.species

NP_640896.2 lcl|XAC0543-XAC0543

1

709

S=2993 I=82 E=0

hypothetical protein

X.species

YP_362303.1 lcl|xopX-XCV0572

1

709

S=2904 I=81 E=0

outer protein X

X.species

NP_635921.2 lcl|XCC0529

1

659

S=2396 I=73 E=0

hypothetical protein

X.species

NP_635922.2 lcl|XCC0530

99

659

S=1657 I=56 E=0

hypothetical protein

pubmed

1

709

S=2904 I=81 E=0

Effector protein

Pubmed 15743446

 

prodomImg

Iprscan [seg]

85

98

-

Iprscan [seg]

311

320

-

Iprscan [seg]

462

476

-

Iprscan [seg]

660

685

-

PD691743

1

709

S=2462 I=70 E=0

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dh0JI8O1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCpcS81/XFF4834R_chr05370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCpcS81/XFF4834R_chr05370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCpcS81/XFF4834R_chr05370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBCpcS81/XFF4834R_chr05370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.