Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04820crpXFF4834R_chr04820probable DNA-binding transcriptional dual regulator.

crp XFF4834R_chr04820
XFF4834R_chr04810
XFF4834R_chr04810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04830
XFF4834R_chr04830
ID crp
AC XFF4834R_chr04820
LT XFF4834R_chr04820
OR XFF4834R_chr from 548619 to 549311 on strand -
DE probable DNA-binding transcriptional dual regulator.
IP Winged helix-turn-helix transcription repressor DNA-binding; Helix-turn-helix motif, Crp-type; RmlC-like jelly roll fold
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
Biological Process: regulation of transcription (GO:0045449)
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN cAMP Receptor Protein
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20100818)
MW 25621 Da
SQ 230 aa
 
........10........20........30........40........50
| | | | |
MSPGNTTVVTTTVRNATPSLALDAGTIERFLAHSHRRRYPTRTDVFRPGD
PAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREV
ILRTRTQCELAEISYERLQQLFQTSLSPDAPKILYAIGVQLSKRLLDTTR
KASRLAFLDVTDRIVRTLHDLAKEPEAMSHPQGTQLRVSRQELARLVGCS
REMAGRVLKKLQADGLLHARGKTVVLYGTR
XFF4834R

XFF4834R_chr02310 lcl|XFF4834R_chr02410563_0271621_f2_XFF4834R-XFF4834R_chr02310

37

121

S=101 I=31 E=6.85719e-06

X.species

YP_362250.1 lcl|clp-XCV0519

1

230

S=1147 I=97 E=3.79168e-132

cAMP-regulatory protein

X.species

NP_640838.1 lcl|clp-XAC0483

1

230

S=1147 I=97 E=3.79168e-132

cAMP-regulatory protein

X.species

NP_635866.1 lcl|clp-XCC0472

1

230

S=1127 I=95 E=1.22824e-129

cAMP-regulatory protein

X.species

lcl|XALc_0286

1

230

S=1005 I=85 E=6.41845e-115

putative cap-like protein

X.species

YP_361997.1 lcl|XCV0266

37

121

S=104 I=32 E=1.08828e-05

putative cyclic nucleotide-binding protein

X.species

NP_640614.1 lcl|XAC0258-XAC0258

37

121

S=101 I=31 E=2.53531e-05

hypothetical protein

pubmed

1

230

S=1127 I=95 E=4.91677e-128

Catabolite activation-like protein ; DNA-binding Transcription regulation

Pubmed 2170330,1322886

 

prodomImg

pubmed

1

230

S=1122 I=94 E=1.59536e-127

CAP-like protein ; DNA-binding Transcription regulation

Pubmed 11361081

 

prodomImg

pubmed

14

230

S=993 I=88 E=7.05825e-112

cAMP regulatory protein ; DNA-binding Transcription regulation

Pubmed 17574998

 

prodomImg

pubmed

14

230

S=925 I=83 E=1.497e-103

Clp Clp regulator ; DNA-binding Transcription regulation

Pubmed 15640196

 

prodomImg

pubmed

27

230

S=558 I=49 E=3.4208e-59

Cyclic AMP receptor-like protein ; cAMP cAMP-binding DNA-binding Nucleotide-binding Transcription regulation Virulence

Pubmed 8002577

 

prodomImg

sp

1

230

S=1127 I=95 E=3.35645e-128

Catabolite activation-like protein ; DNA-binding Transcription regulation

 

prodomImg

sp

27

230

S=558 I=49 E=2.33522e-59

Cyclic AMP receptor-like protein ; cAMP cAMP-binding DNA-binding Nucleotide-binding Transcription regulation Virulence

 

prodomImg

sp

27

230

S=555 I=47 E=6.70649e-59

Catabolite gene activator ; cAMP cAMP-binding Competence DNA-binding Nucleotide-binding Transcription regulation

 

prodomImg

sp

15

230

S=548 I=47 E=4.85324e-58

Catabolite gene activator ; cAMP cAMP-binding DNA-binding Nucleotide-binding Transcription regulation

 

prodomImg

sp

26

230

S=544 I=46 E=1.27742e-57

Catabolite gene activator ; Acetylation cAMP cAMP-binding DNA-binding Nucleotide-binding Transcription regulation

 

prodomImg

Iprscan IPR001808 [PR00034]

186

202

HTH transcriptional regulator, Crp

Iprscan IPR001808 [PR00034]

202

217

HTH transcriptional regulator, Crp

Iprscan IPR014710 [G3DSA:2.60.120.10]

22

158

RmlC-like jelly roll fold

Iprscan IPR011991 [G3DSA:1.10.10.10]

159

230

Winged helix-turn-helix transcription repressor DNA-binding

Iprscan [PTHR10217]

21

123

-

Iprscan IPR000595 [PF00027]

37

124

Cyclic nucleotide-binding

Iprscan IPR001808 [PF00325]

186

217

HTH transcriptional regulator, Crp

Iprscan IPR000595 [SM00100]

18

137

Cyclic nucleotide-binding

Iprscan IPR001808 [SM00419]

180

228

HTH transcriptional regulator, Crp

Iprscan IPR018335 [PS00042]

188

211

Transcription regulator Crp-type HTH, conserved site

Iprscan IPR000595 [PS50042]

22

122

Cyclic nucleotide-binding

Iprscan IPR012318 [PS51063]

158

230

Helix-turn-helix motif, Crp-type

Iprscan [seg]

6

13

-

PDA6V479

165

230

S=325 I=95 E=6.5576e-32

PD580652

166

230

S=222 I=58 E=2.01669e-19

PD876131

1

44

S=158 I=68 E=1.11697e-11

PDA8D2A1

26

105

S=142 I=35 E=8.81211e-10

PD782716

54

164

S=139 I=28 E=2.18211e-09

Iprscan IPR018490 [SSF51206]

13

158

Cyclic nucleotide-binding-like

Iprscan [SSF46785]

159

229

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4ImY6xfK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

13 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtC2AnP/XFF4834R_chr04820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtC2AnP/XFF4834R_chr04820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtC2AnP/XFF4834R_chr04820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtC2AnP/XFF4834R_chr04820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.