Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04400XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400XFF4834R_chr04400putative tryptophan 2,3-dioxygenase

XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400 XFF4834R_chr04400
XFF4834R_chr_0485
XFF4834R_chr_0485
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04410
XFF4834R_chr04410
ID XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400
AC XFF4834R_chr04400
LT XFF4834R_chr04400
OR XFF4834R_chr from 507599 to 508495 on strand +
DE putative tryptophan 2,3-dioxygenase
IP Tryptophan 2,3-dioxygenase
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro
3-dioxygenase activity (GO:0004833)
Biological Process: tryptophan catabolic process to kynurenine (GO:0019441)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 34430.8 Da
SQ 298 aa
 
........10........20........30........40........50
| | | | |
MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEML
FIIQHQTSELWLKLLAHELRAAIAHLQRDEVWQCRKVLARSKQVLRQLTE
QWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFA
YDPHGQARLREALEAPSLYEEFLRYLARFGHAIPAHYQARDWTAAHVADD
SLRPVFERIYENTDRYWREYALCEDLVDVETQFQLWRFRHMRTVMRVIGF
KRGTGGSSGVGFLQQALALTFFPELFDVRTSVGLDGRPPQGAPDAAQG
X.species

YP_362209.1 XCV0478

1

298

S=1567 I=99 E=0

tryptophan 2,3-dioxygenase

X.species

NP_635826.1 XCC0432

1

297

S=1516 I=96 E=1.05237e-176

tryptophan 2,3-dioxygenase

X.species

NP_640803.1 XAC0448-XAC0448

1

296

S=1500 I=96 E=1.14632e-174

tryptophan 2,3-dioxygenase

X.species

XALc_2742 XALc_2742

1

285

S=1294 I=86 E=1.03791e-149

probable tryptophan 2,3-dioxygenase protein

X.species

NP_636584.1 XCC1210

220

298

S=135 I=41 E=2.22753e-09

tryptophan 2,3-dioxygenase

pubmed

1

297

S=1516 I=96 E=4.34273e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 17197414

 

prodomImg

pubmed

13

282

S=644 I=48 E=2.14031e-69

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 14700627,17198384

 

prodomImg

pubmed

17

282

S=567 I=44 E=4.26711e-60

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 15066027

 

prodomImg

pubmed

17

191

S=407 I=51 E=1.08636e-40

ORF1 ; Plasmid

Pubmed 11976102,14594853

 

prodomImg

pubmed

24

282

S=396 I=36 E=2.52872e-39

SibP

Pubmed 19270142

 

prodomImg

sp

1

298

S=1567 I=99 E=0

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

 

prodomImg

sp

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

 

prodomImg

sp

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

 

prodomImg

sp

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

 

prodomImg

sp

1

296

S=1500 I=96 E=3.22047e-173

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

 

prodomImg

Iprscan IPR004981 [PTHR10138]

12

291

Tryptophan 2,3-dioxygenase

Iprscan IPR004981 [PF03301]

18

144

Tryptophan 2,3-dioxygenase

Iprscan IPR004981 [PF03301]

208

281

Tryptophan 2,3-dioxygenase

PD563815

86

178

S=249 I=54 E=1.08965e-22

PDA1G0M2

22

83

S=191 I=66 E=1.10235e-15

PD008769

209

276

S=181 I=51 E=1.94124e-14

PDA1V7V4

192

219

S=150 I=96 E=9.71618e-11

PDA8N1O1

274

298

S=126 I=96 E=7.20554e-08

PDA1G6N0

140

191

S=116 I=52 E=1.16295e-06

PDA3B0J5

1

21

S=111 I=100 E=4.85902e-06

PDA8N1R5

136

282

S=102 I=35 E=6.47352e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CxxM5vl0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

110 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG5rHOD/XFF4834R_chr04400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG5rHOD/XFF4834R_chr04400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG5rHOD/XFF4834R_chr04400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG5rHOD/XFF4834R_chr04400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.