Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04250XFF4834R_chr_0485904_0486662_r2_XFF4834R-XFF4834R_chr04250XFF4834R_chr04250putative short chain dehydrogenase/reductase protein

XFF4834R_chr_0485904_0486662_r2_XFF4834R-XFF4834R_chr04250 XFF4834R_chr04250
XFF4834R_chr_0466
XFF4834R_chr_0466
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04260
XFF4834R_chr04260
ID XFF4834R_chr_0485904_0486662_r2_XFF4834R-XFF4834R_chr04250
AC XFF4834R_chr04250
LT XFF4834R_chr04250
OR XFF4834R_chr from 485904 to 486662 on strand -
DE putative short chain dehydrogenase/reductase protein
IP Short-chain dehydrogenase/reductase SDR
CL 1 Metabolism GO:0008152
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [IQR] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100826)
MW 26353.3 Da
SQ 252 aa
 
........10........20........30........40........50
| | | | |
MSNTALRPQRVLIAGGSRGIGLAIAEAFVRNGAQVSICARNAAGLAQAAD
ALAAQGDAVHTLPCDLADATQIDAYVHAAAQALDGLDVVINNASGFGHGN
DDASWQAGLEIDLMAAVRCNRAALPYLRRSAAAVILNISSINAQRPTPRA
IAYSTAKAALNYYTTTLAAELARERIRVNAISPGSIEFPDGLWDTRSREE
PELYARIRDSIPFGGFGQVQHVADAAFFLASPQASWITGQVLAVDGGQSL
GV
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr36300 XFF4834R_chr_4203541_4204407_f1_XFF4834R-XFF4834R_chr36300

6

247

S=221 I=28 E=2.09401e-20

XFF4834R

XFF4834R_chr37030 hdhA-XFF4834R_chr37030

6

247

S=217 I=29 E=5.90979e-20

7-alpha-hydroxysteroid dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr11200 fabG-XFF4834R_chr11200

6

250

S=185 I=24 E=4.86203e-16

3-oxoacyl-[acyl-carrier-protein] reductase

XFF4834R

XFF4834R_chr35720 XFF4834R_chr38950017_4144763_f3_XFF4834R-XFF4834R_chr35720

12

249

S=169 I=30 E=3.64031e-14

XFF4834R

XFF4834R_chr33650 XFF4834R_chr36460475_3883653_f1_XFF4834R-XFF4834R_chr33650

6

247

S=169 I=26 E=3.70434e-14

predicted glutathionylspermidine synthase, with NAD(P)-binding Rossmann-fold domain

XFF4834R

XFF4834R_chr00540 XFF4834R_chr00550357_0067094_r2_XFF4834R-XFF4834R_chr00540

12

248

S=155 I=27 E=2.13519e-12

XFF4834R

XFF4834R_chr42070 XFF4834R_chr_4886032_4886775_f1_XFF4834R-XFF4834R_chr42070

11

247

S=153 I=29 E=4.00004e-12

XFF4834R

XFF4834R_chr40560 ucpA-XFF4834R_chr40560

2

249

S=151 I=26 E=5.9737e-12

predicted oxidoredutase, sulfate metabolism protein

XFF4834R

XFF4834R_chr22280 XFF4834R_chr24230905_2575708_f2_XFF4834R-XFF4834R_chr22280

9

247

S=141 I=28 E=9.98354e-11

XFF4834R

XFF4834R_chr03700 XFF4834R_chr03820139_0421921_r3_XFF4834R-XFF4834R_chr03700

12

252

S=138 I=25 E=2.47219e-10

XFF4834R

XFF4834R_chr24120 XFF4834R_chr26320683_2781423_f1_XFF4834R-XFF4834R_chr24120

65

251

S=135 I=24 E=5.56194e-10

XFF4834R

XFF4834R_chr30120 XFF4834R_chr32700758_3461489_r2_XFF4834R-XFF4834R_chr30120

1

141

S=127 I=30 E=5.27405e-09

XFF4834R

XFF4834R_chr21510 XFF4834R_chr23410899_2494657_r3_XFF4834R-XFF4834R_chr21510

68

247

S=121 I=28 E=2.78848e-08

XFF4834R

XFF4834R_chr19950 XFF4834R_chr21420061_2289831_r1_XFF4834R-XFF4834R_chr19950

6

250

S=120 I=26 E=3.7181e-08

XFF4834R

XFF4834R_chr33630 XFF4834R_chr36420709_3879689_f3_XFF4834R-XFF4834R_chr33630

8

153

S=115 I=27 E=1.44883e-07

XFF4834R

XFF4834R_chr24850 XFF4834R_chr27180722_2869576_r3_XFF4834R-XFF4834R_chr24850

62

183

S=112 I=28 E=3.61909e-07

predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain

XFF4834R

XFF4834R_chr11610 XFF4834R_chr12100415_1297155_r1_XFF4834R-XFF4834R_chr11610

86

251

S=110 I=25 E=5.69505e-07

XFF4834R

XFF4834R_chr06960 XFF4834R_chr07280130_0797867_r2_XFF4834R-XFF4834R_chr06960

11

250

S=109 I=27 E=8.65466e-07

XFF4834R

XFF4834R_chr38070 XFF4834R_chr_4396726_4397481_f1_XFF4834R-XFF4834R_chr38070

9

187

S=107 I=27 E=1.20542e-06

L-allo-threonine dehydrogenase, NAD(P)-binding

XFF4834R

XFF4834R_chr39580 XFF4834R_chr_4561110_4561841_r2_XFF4834R-XFF4834R_chr39580

9

248

S=106 I=24 E=1.75371e-06

XFF4834R

XFF4834R_chr00840 kduD-XFF4834R_chr00840

83

247

S=104 I=26 E=2.8082e-06

2-deoxy-D-gluconate 3-dehydrogenase

XFF4834R

XFF4834R_chr04320 XFF4834R_chr_0495790_0496713_f1_XFF4834R-XFF4834R_chr04320

1

183

S=96 I=24 E=3.11532e-05

XFF4834R

XFF4834R_chr05910 XFF4834R_chr06130043_0666777_r1_XFF4834R-XFF4834R_chr05910

11

187

S=92 I=25 E=7.78191e-05

X.species

NP_640788.1 XAC0433-XAC0433

1

252

S=1072 I=84 E=5.53373e-123

3-oxoacyl-[ACP] reductase

X.species

YP_362190.1 XCV0459

1

252

S=1053 I=83 E=1.21082e-120

short chain dehydrogenase

X.species

NP_635810.1 XCC0416

1

252

S=932 I=72 E=6.11051e-106

3-oxoacyl-[ACP] reductase

X.species

YP_365589.1 XCV3858

6

247

S=220 I=28 E=1.06541e-19

short chain dehydrogenase

X.species

NP_644046.1 XAC3738-XAC3738

6

247

S=218 I=28 E=1.78205e-19

oxidoreductase

X.species

NP_639105.1 trn2-XCC3760

6

247

S=216 I=28 E=3.05973e-19

tropinone reductase

X.species

YP_365667.1 trn2-XCV3936

6

247

S=214 I=28 E=4.69052e-19

tropinone reductase

X.species

NP_644117.1 trn2-XAC3811

6

247

S=213 I=29 E=7.57668e-19

tropinone reductase

X.species

NP_639041.1 XCC3695

6

247

S=211 I=27 E=1.23459e-18

oxidoreductase

X.species

XALc_0626 fabG-XALc_0626

6

250

S=198 I=27 E=4.25446e-17

probable 3-oxoacyl-(acyl-carrier protein) reductase

pubmed

4

252

S=303 I=34 E=3.38943e-28

Isoepoxydon dehydrogenase

Pubmed 17043910

 

prodomImg

pubmed

4

247

S=300 I=35 E=8.17643e-28

Isoepoxydon dehydrogenase

Pubmed 17043910

 

prodomImg

pubmed

4

252

S=299 I=34 E=1.16899e-27

Isoepoxyedon dehydrogenase

Pubmed 16436057

 

prodomImg

pubmed

3

252

S=290 I=33 E=1.39052e-26

Isoepoxydon dehydrogenase

Pubmed 16328863,17043910

 

prodomImg

pubmed

3

252

S=290 I=33 E=1.39052e-26

Isoepoxydon dehydrogenase

Pubmed 17043910

 

prodomImg

sp

5

247

S=244 I=29 E=3.55392e-21

Tropinone reductase 1 EC=1.1.1.206 ; NADP Oxidoreductase

 

prodomImg

sp

6

250

S=233 I=28 E=6.88842e-20

Glucose 1-dehydrogenase 2 EC=1.1.1.47 ; NADP Oxidoreductase Stress response

 

prodomImg

sp

3

247

S=229 I=28 E=2.52527e-19

7-alpha-hydroxysteroid dehydrogenase EC=1.1.1.159 ; Bile acid catabolism Lipid metabolism NAD Oxidoreductase

 

prodomImg

sp

3

247

S=229 I=28 E=2.52527e-19

7-alpha-hydroxysteroid dehydrogenase EC=1.1.1.159 ; Bile acid catabolism Lipid metabolism NAD Oxidoreductase

 

prodomImg

sp

6

249

S=224 I=30 E=8.48463e-19

2-(S)-hydroxypropyl-CoM dehydrogenase EC=1.1.1.269 ; NAD Oxidoreductase Plasmid

 

prodomImg

Iprscan IPR002347 [PR00081]

10

27

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

84

95

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

127

143

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

153

172

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

174

191

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

212

232

Glucose/ribitol dehydrogenase

Iprscan IPR002198 [PR00080]

84

95

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PR00080]

133

141

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PR00080]

153

172

Short-chain dehydrogenase/reductase SDR

Iprscan IPR016040 [G3DSA:3.40.50.720]

6

250

NAD(P)-binding domain

Iprscan [PTHR19410:SF81]

4

246

-

Iprscan IPR002198 [PTHR19410]

4

246

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PF00106]

11

171

Short-chain dehydrogenase/reductase SDR

Iprscan IPR020904 [PS00061]

140

168

Short-chain dehydrogenase/reductase, conserved site

Iprscan [seg]

42

58

-

Iprscan [seg]

155

172

-

PDA1Y6Q9

188

222

S=181 I=94 E=1.96522e-14

PDA8Q9C6

74

222

S=150 I=28 E=9.33485e-11

PDA1Y6O5

79

112

S=146 I=79 E=3.24771e-10

PDA1W7G2

1

36

S=135 I=78 E=7.17442e-09

PDA2U2P9

37

78

S=116 I=60 E=1.36541e-06

PDA869G1

177

247

S=105 I=39 E=3.23418e-05

Iprscan IPR016040 [SSF51735]

7

248

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PRF9hZPW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

260 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

23 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExMKvf/XFF4834R_chr04250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExMKvf/XFF4834R_chr04250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExMKvf/XFF4834R_chr04250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExMKvf/XFF4834R_chr04250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.