Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04090XFF4834R_chr04170468_0460036_r3_XFF4834R-XFF4834R_chr04090XFF4834R_chr04090conserved hypothetical protein

XFF4834R_chr04170468_0460036_r3_XFF4834R-XFF4834R_chr04090 XFF4834R_chr04090
XFF4834R_chr04080
XFF4834R_chr04080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04100
XFF4834R_chr04100
ID XFF4834R_chr04170468_0460036_r3_XFF4834R-XFF4834R_chr04090
AC XFF4834R_chr04090
LT XFF4834R_chr04090
OR XFF4834R_chr from 458468 to 460264 on strand -
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130514)
MW 63739.5 Da
SQ 598 aa
 
........10........20........30........40........50
| | | | |
MQGQLGTAYAPCRVGVPHITHDCQVDTSGYEAIFRCNQNARRHARLDEAP
IVRRHRSVGMRAWATHADIPPTRGHAVTKISSASTSQQPQATSGDIVIEI
PAQQRNDTSTPRIDSPLSALPPRPSGRRNSAGSDSGYETATDADLSAPYG
SPRLQASLRREDSDSERFYDAEDSFEPSAPSALPQQHAAQHGYQAHASTS
ATGAARLGTLAASVRAGATRGVTTILGPTATAVAAAARGVLPISFDTQYL
GAALGHLVHQTTSVGPTTFVRELLGEGLFATLRQLPPEAVVAMQAVSGTL
HLALHTLRRNRENRNPDAAARGFHNLNLEQWEALSEDERHHKRSEQQHYS
DLVTRLALVGILSNIAIGAAGKASGRPDLAARLLASELKVAPYAAARDAI
QATFRMVGMRAPTNGGVSDPHVTSAGRFYGMANVLTNLASNELELPDFAS
ARQRWAGLMSPFNMGEATNVVFQQAAVNAALNVGLETADWLNVTQHEADE
AGTQQIWEPTFKARREDYERVMDHSVARTAAINSNIAFGTAVNMIGTWLG
LSPARSALLSNALAGMAAGMQYKIIAGTWQAAAAVREAEAARTQAESA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pXnp5sAg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQDqUH/XFF4834R_chr04090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQDqUH/XFF4834R_chr04090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQDqUH/XFF4834R_chr04090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQDqUH/XFF4834R_chr04090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.