Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04080HpaHXFF4834R_chr04080Lytic transglycosylase-like HpaH protein, type III secretion system

HpaH XFF4834R_chr04080
XFF4834R_chr04070
XFF4834R_chr04070
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04090
XFF4834R_chr04090
ID HpaH
AC XFF4834R_chr04080
LT XFF4834R_chr04080
OR XFF4834R_chr from 457569 to 458132 on strand +
DE Lytic transglycosylase-like HpaH protein, type III secretion system
IP Lytic transglycosylase-like, catalytic
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 20813.3 Da
SQ 187 aa
 
........10........20........30........40........50
| | | | |
MSESTIAYQHVDQQSNWHLGRSSGPSPKRPVRTKRSGCGRRAGAGPQRIL
FAAALACAAPFARADCFEEAAGYQHVNPWVLRAIAWQESRGRADAIHRNN
NGTVDYGKMQINSIHLRRLSSYGISRDALMHPCISVYVAAWRLREMTNKY
GNTWAAVGAYHSETPGERDKYAHAIHSILLRRGVIAD
X.species

YP_362172.1 lcl|hpaH-XCV0441

31

187

S=683 I=85 E=5.38602e-76

putative transglycosylase HpaH

X.species

NP_640772.1 lcl|hpa2-XAC0417

65

187

S=655 I=98 E=1.35378e-72

Hpa2 protein

X.species

NP_636615.1 lcl|hpa2-XCC1241

65

187

S=625 I=92 E=6.2645e-69

Hpa2 protein

X.species

YP_361599.1 lcl|XCVd0040

65

175

S=203 I=42 E=8.1455e-18

putative lytic murein transglycosylase

X.species

lcl|xapC-XALc_1482

65

176

S=179 I=39 E=6.70697e-15

conserved hypothetical protein.

pubmed

1

187

S=853 I=89 E=5.44928e-95

HpaH

Pubmed 12730176

 

prodomImg

pubmed

1

187

S=745 I=78 E=5.83046e-82

Hpa2 Hpa2 protein

Pubmed 18431569

 

prodomImg

pubmed

1

187

S=745 I=78 E=5.83046e-82

Hpa2

Pubmed 18431569

 

prodomImg

pubmed

1

187

S=723 I=76 E=2.84526e-79

Hpa2

Pubmed 16957248

 

prodomImg

pubmed

31

187

S=683 I=85 E=2.05214e-74

HpaH ; Signal

Pubmed 8664494,11844763

 

prodomImg

sp

65

181

S=222 I=43 E=8.6066e-19

Protein ipgF ; Plasmid Signal Virulence

 

prodomImg

sp

65

181

S=221 I=43 E=1.43958e-18

Protein ipgF ; Plasmid Signal Virulence

 

prodomImg

sp

65

168

S=214 I=45 E=9.97331e-18

Invasion protein iagB ; Signal Virulence

 

prodomImg

sp

65

168

S=213 I=45 E=1.08819e-17

Invasion protein iagB ; Signal Virulence

 

prodomImg

sp

65

162

S=188 I=41 E=1.11423e-14

X polypeptide ; Plasmid

 

prodomImg

Iprscan [G3DSA:1.10.530.10]

56

160

-

Iprscan IPR008258 [PF01464]

65

162

Lytic transglycosylase-like, catalytic

Iprscan [seg]

52

64

-

PD710205

1

51

S=184 I=73 E=7.57945e-15

PD017223

103

171

S=142 I=49 E=9.89022e-10

PDA1I231

65

87

S=131 I=100 E=2.36316e-08

PDA3Y1T9

65

93

S=107 I=76 E=1.84665e-05

PDA2I7H2

163

187

S=105 I=76 E=3.34092e-05

Iprscan [SSF53955]

53

183

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QUv3jlGM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

75 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpbSZFB/XFF4834R_chr04080.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpbSZFB/XFF4834R_chr04080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpbSZFB/XFF4834R_chr04080.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpbSZFB/XFF4834R_chr04080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.